SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005543 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005543
Domain Number 1 Region: 24-131,227-403
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 2.27e-105
Family Pyruvate kinase 0.000000000867
Further Details:      
 
Domain Number 2 Region: 407-539
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 4.32e-41
Family Pyruvate kinase, C-terminal domain 0.00000154
Further Details:      
 
Domain Number 3 Region: 126-227
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 6.8e-28
Family Pyruvate kinase beta-barrel domain 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005543   Gene: ENSMMUG00000004145   Transcript: ENSMMUT00000005886
Sequence length 540
Comment pep:known chromosome:MMUL_1:13:114212247:114213869:1 gene:ENSMMUG00000004145 transcript:ENSMMUT00000005886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQRRRTSAAMSKPHSEAGTAVIQTQQLHAAMADTFLEHMCRLDIDSPPATARNTGIICTI
GPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATEGFASDPILYRPVAVA
LDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVG
SKIYVDDGLISLQVKQKGADFLVTEVENGGSSGSKKGVNLPGAAVDLPAVSEKDIQDLKF
GVEQDVDMVLASFILKAADVHEVRKVLGEKGNDIKIISKIENHEGVRRFDEILEASDGIM
VARGDVGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANA
ILDGADCIMLSGETAKGDYPLETVRMQHLIAREAEAAIYHLQLFEELHRLAPITSDPTEA
TTVGAVEASFKCCSGAIIVPTKSGRSAHQVARYCPRAPIIAGTRNPQTARQAHLYCGIFP
VLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGCRPGSGFTNTMRVVPVP
Download sequence
Identical sequences ENSMMUP00000005543 9544.ENSMMUP00000005543 ENSMMUP00000005543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]