SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005549 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005549
Domain Number 1 Region: 23-601
Classification Level Classification E-value
Superfamily ARM repeat 2.75e-100
Family Clathrin adaptor core protein 0.00000087
Further Details:      
 
Domain Number 2 Region: 658-783
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 1.57e-38
Family gamma-adaptin C-terminal appendage domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005549   Gene: ENSMMUG00000004144   Transcript: ENSMMUT00000005892
Sequence length 785
Comment pep:known chromosome:MMUL_1:7:86398790:86407370:-1 gene:ENSMMUG00000004144 transcript:ENSMMUT00000005892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAPSLKLQDLIEEIRGAKTQAQEREVIQKECAHIRASFRDGDPVHRHRQLAKLLYVHML
GYPAHFGQMECLKLIASSRFTDKRVGYLGAMLLLDERHDAHLLITNSIKNDLSQGIQPVQ
GLALCTLSTMGSAEMCRDLAPEVEKLLLQPSPYVRKKAILTAVHMIRKVPELSSVFLPPC
VHLLHERHHGILLGTITLITELCERSPAALRHFRKVVPQLVQILRTLVTTGYSTEHSISG
VSDPFLQVQILRLLRILGRNHEESSETMNDLLAQVATNTDTSRNAGNAVLFETVLTIMDI
RSAAGLRVLAVNILGRFLLNSDRNIRYVALTSLLRLVQSDHSAVQRHRPTVVDCLQETDA
SLSRRALELSLALVNSSNVRAMMQELQAFLESCPPDLRADCASGILLAAERFAPTKRWHI
DTILHVLTTAGTHVRDDAVANLTQLIGGAQELHAYSVRRLYNALAEDISQQPLVQVAAWC
IGEYGDLLLEGNCEEIEPLQVDEEEVLALLEKVLQSHMSLPATRGYALTALMKLSTRLQG
DNNRIRQVVSIYKSCLDVELQQRAVEYDTLFRKYDHMRAAILEKMPLVERDGPQADEEAK
ESKAAAQLSEAVPAPTEPQASQLLDLLDLLDGASGDAQHPPPLDPSPGGALVYLLDLPCA
PPPPAPIPDLKVFEREGVQLNLSFIRPPENPALLLITATATNSSEGDVTDFICQAAVPKS
LQLQMQAPSGNTVPARGGLPITQLFRILNPNKAPVRLKLRLTYNHFHQSVQEIFEVNNLP
VESWQ
Download sequence
Identical sequences A0A2K5WMH6 F6XKB0
ENSMMUP00000005549 NP_001253936.1.72884 XP_005560939.1.63531 XP_005560940.1.63531 XP_014998789.1.72884 XP_014998790.1.72884 XP_015309087.1.63531 ENSMMUP00000005549 ENSMMUP00000005550 9544.ENSMMUP00000005550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]