SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005646 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005646
Domain Number 1 Region: 498-678
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.87e-46
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.031
Further Details:      
 
Domain Number 2 Region: 367-465
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000785
Family WWE domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000005646
Domain Number - Region: 177-200
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0012
Family CCCH zinc finger 0.0051
Further Details:      
 
Domain Number - Region: 295-326
Classification Level Classification E-value
Superfamily WWE domain 0.0432
Family WWE domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005646   Gene: ENSMMUG00000004224   Transcript: ENSMMUT00000005996
Sequence length 701
Comment pep:known chromosome:MMUL_1:3:177511252:177549719:-1 gene:ENSMMUG00000004224 transcript:ENSMMUT00000005996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAGVVGEVTQVLCAAGGALELPELRRRLRMGLSADALERLLRQRGRFVVAVRAGGAAA
AQERVVLAASPLRLCRAHQGSKPGCVGLCAQLHLCKFMVYGACKFLRAGKNCRNSHSLTT
EHNLSVLRTHGVDHLSYNELCQLLFQNDPWLLPEICQHYNKGDGPHGSCAFQKQCIKLHI
CQYFLQGECKFGKSCKRSHDFSNSENLEKLEKLGMSSDLVSRLPSIYRNAHDIKNKSSAP
SRVPPPFVPQGTSERKDSSGSVSPNTLSQEEGDQICLYHIRKSCSFQDKCHRVHFHLPYR
WQFLDRGKWKDLDKMELIEEAYCNPKIERILCSESANTFHSDCLNFNAMTYGATQARRLS
TASAVTKPPHFILTTDWIWYWSDEFGSWQEYGRQGTAHPVTTVSSSDVEKAYLAYCTPGS
DGQAATLKFQAGKHNYELDFKAFIQKNLVYGTTKKVCRRPKYVSPQDVTTLQTCNTKFPG
PKSIPDYWDSSALPDPGFQKITLSSSSEEYQKVWNLFNRTLPFYFVQKIERVQNLALWEV
YQWCVGARCWWAGGFAVDERQLFHGTSAIFVDAICQQNFDWRVCGVHGTSYGKGNYFARD
AAYSHHYSKSDTQTHTMFLARVLVGEFVRGNASFVRPPAKEGRSNAFYDSCVNSVSDPSI
FVIFEKHQVYPEYLIQYTTSSKPSVTPSILLALGSLFSSRQ
Download sequence
Identical sequences ENSMMUP00000005646 ENSMMUP00000005646 9544.ENSMMUP00000005646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]