SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005692 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000005692
Domain Number - Region: 116-160
Classification Level Classification E-value
Superfamily ISP domain 0.0785
Family Rieske iron-sulfur protein (ISP) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005692   Gene: ENSMMUG00000004258   Transcript: ENSMMUT00000006048
Sequence length 263
Comment pep:known chromosome:MMUL_1:3:5281513:5331045:-1 gene:ENSMMUG00000004258 transcript:ENSMMUT00000006048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSRWACWFTRCLISCFDINIQGHLRPKPTANTTCPSIPVVFLVLASLCAWYSGYLLAELI
PDAPLSSAAYSIHSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGINKYAKICF
EDDLLMGEKLGNVARGINIAIVNYVTGNVTATQHFDMYEGDNSGPMIKFIQSAPPKSLLF
MVTYDDGSTRLNNDAKNAIEELGSKEIRNMKFRSSWVFLAAKGFELPSEIQREKINHSDT
KNNRYSGWPAEIQIEGCIPKEPS
Download sequence
Identical sequences ENSMMUP00000005692 ENSMMUP00000005692 9544.ENSMMUP00000005692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]