SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005743 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005743
Domain Number 1 Region: 265-521
Classification Level Classification E-value
Superfamily Kelch motif 8.24e-33
Family Kelch motif 0.0048
Further Details:      
 
Domain Number 2 Region: 57-164
Classification Level Classification E-value
Superfamily POZ domain 1.13e-31
Family BTB/POZ domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005743   Gene: ENSMMUG00000004289   Transcript: ENSMMUT00000006100
Sequence length 543
Comment pep:known chromosome:MMUL_1:14:24533178:24539128:1 gene:ENSMMUG00000004289 transcript:ENSMMUT00000006100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNSASYSRWCCFADSWQREKLASMESPEEPGASMDENYFVNYTFKDRSHSGRVAQGIM
KLCLEEELFADVTISVEGREFQLHRLVLSAQSCFFRSMFTSNLKEAHNRVIVLQDVSESV
FQLLVDYIYHGTVKLRAEELQEIYEVSDMYQLTSLFEECSRFLARTVQVGNCLQVMWLAD
RHSDPELYTAAKHCAKTHLAQLQNTEEFLHLPHHLLTDIISDGVPCSQNPTEAIEAWINF
NKEEREAFAESLRTSLKEIGENVHIYLIGKESSRTHSLAVSLHCAEDDSISVSGQNSLCH
QITAACKHGGDLYVVGGSIPRRMWKCNNATVDWEWCAPLPRDRLQHTLVSVPGKDAIYSL
GGKTLQDTLSNAVIYYRVGDNVWTETTQLEVAVSGAAGANLNGIIYLLGGEENDLDFFTK
PSRLIQCFDTETDKCHVKPYVLPFAGHMHAAVHKDLVFIVAEGDSLVCYNPLLDSFTRLC
LPEAWSSAPSLWKIASCNGSIYVFRDRYKKGDANTYKLDPATSAVTVTRGIKVLLTNLQF
VLA
Download sequence
Identical sequences A0A096MP04 A0A2K5V5A2 F6ZLM2
ENSMMUP00000005743 9544.ENSMMUP00000005742 XP_005577981.1.63531 XP_007997500.1.81039 XP_014969668.1.72884 ENSMMUP00000005742 ENSPANP00000001437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]