SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005756 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005756
Domain Number 1 Region: 476-660
Classification Level Classification E-value
Superfamily Fibronectin type III 9.48e-34
Family Fibronectin type III 0.00027
Further Details:      
 
Domain Number 2 Region: 183-282
Classification Level Classification E-value
Superfamily Immunoglobulin 3.19e-23
Family I set domains 0.0015
Further Details:      
 
Domain Number 3 Region: 280-386
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-18
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 376-472
Classification Level Classification E-value
Superfamily Immunoglobulin 5.84e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 5 Region: 4-94
Classification Level Classification E-value
Superfamily Immunoglobulin 7.27e-16
Family I set domains 0.0016
Further Details:      
 
Domain Number 6 Region: 97-193
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000687
Family I set domains 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005756   Gene: ENSMMUG00000004300   Transcript: ENSMMUT00000006113
Sequence length 819
Comment pep:known chromosome:MMUL_1:3:25328653:25587219:-1 gene:ENSMMUG00000004300 transcript:ENSMMUT00000006113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEKIISTQRIVVQKEGVRSRL
TIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREVVSPQEFKQGEDAEVVCRV
SSSPAPAVSWLYHNEEVTAISDNRFAMLANNNLQILNINKSDEGIYRCEGRVEARGEIDF
RDIIVIVNVPPAISMPQKSFNATAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYV
LKRSNTELTVRNIVNSDGGPYVCRATNKAGEDEKQAFLQVFVQPHIIQLKNETTFENGQV
TLICDAEGEPIPEITWKRAVDGFTFTEGDKSPDGRIEVKGQHGSSSLHIKDVKLSDSGRY
DCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINISCDVKSNPPASIHWRREK
LVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNRIGTRFQEYILALADVPSS
PYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASEIWKIVRSHGVQTMVVLSN
LEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDD
GGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPT
VYEFSMPPKPNIIKDTLFNGLGLGAVIGLGVAALLLILVVTDVSCFFIRQCGLLMCITRR
MCGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRTEDERITNHEDGSPVNEPNETTPLT
EPEKLPLKEENGKEALNPETIEIKVSNDIIQSKEDDSKA
Download sequence
Identical sequences ENSMMUP00000005756 9544.ENSMMUP00000005756 ENSMMUP00000005756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]