SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005793 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005793
Domain Number 1 Region: 3158-3333
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.05e-31
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 2988-3151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-29
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 3 Region: 2590-2761
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-20
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 4 Region: 2760-2929
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.42e-20
Family Laminin G-like module 0.008
Further Details:      
 
Domain Number 5 Region: 2388-2579
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000072
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 6 Region: 1357-1408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000159
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1688-1730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 8 Region: 1267-1315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 9 Region: 1740-1790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000187
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 10 Region: 538-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 11 Region: 356-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 12 Region: 493-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.009
Further Details:      
 
Domain Number 13 Region: 299-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000197
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 14 Region: 1406-1454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 15 Region: 633-683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 16 Region: 426-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 17 Region: 686-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000005793
Domain Number - Region: 588-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000109
Family Laminin-type module 0.012
Further Details:      
 
Domain Number - Region: 104-184
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0017
Family APC10-like 0.064
Further Details:      
 
Domain Number - Region: 1653-1690
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family Laminin-type module 0.046
Further Details:      
 
Domain Number - Region: 1319-1354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00377
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 2233-2388
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00889
Family HBL-like 0.068
Further Details:      
 
Domain Number - Region: 1859-1996
Classification Level Classification E-value
Superfamily Tropomyosin 0.0432
Family Tropomyosin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005793   Gene: ENSMMUG00000004321   Transcript: ENSMMUT00000006152
Sequence length 3334
Comment pep:known chromosome:MMUL_1:18:16897610:16979713:1 gene:ENSMMUG00000004321 transcript:ENSMMUT00000006152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAARPRGRAPGPVLPPTPLLLLVLQLLPAWGATARDPRAAAGLSLHPPYFNLAEAARI
WATATCGERGPSERRPRPELYCKLVGGPTAPGSGHTIQGQFCDYCNSEDPRKAHPVTNAI
DGSEHWWQSPPLSSGTQYNRVNLTLDLGQLFHVAYILIKFANSPRPDLWVLERSVDFGST
YSPWQYFAHSKVDCLKEFGREANMAVTRDDDVLCVTEYSRIVPLENGEVVVSLINGRPGA
KNFTFSHTLREFTKATNIRLRFLRTNTLLGHLISKAQRDPTVTRRYYYSIKDISIGGRCV
CNGHAEVCNANNPEKLFRCQCQHHTCGETCDRCCTGYNQRRWQPAAWEQSHECEACNCHG
HASDCYYDSDVERQQASLNTQGIYAGGGVCINCQHNTAGVNCEQCAKGYYRPYGVPVDAP
DGCIPCSCDPEHADGCEQGSGRCHCKPNFHGDNCEKCAVGYYNFPFCLKIPIFPVSTPSP
EDPVAGDIRGKWCDCNPEGVLPEICDAHGRCLCRPGVEGPRCDTCRSGFYSFPICQACWC
SALGSYQMPCSSVTGQCECRPGVTGQRCDRCLSGAYDFPHCQGSSSACDPAGTIDSNLGS
CPCKLHVEGPTCSICKPLYWNLDKENPNGCSECQCHKAGTVSGTGECRQGDGDCHCKSHV
GGDSCDTCEDGYFALEKSNYFGCQGCQCDIGGALSSVCSGPSGVCQCREHVVGKACQRPE
NNYYFPDLHHMKYEIEDGSTPNGRDLRFGFDPLAFPGFSWRGYAQMTSVQGQAWLTVWLD
SSLGALSFVTFPSLNNHLKKCLKQFFVFLIGAAQSKEIIFLPSKEPAFVTVPGNGFADPF
SITPGIWVACIKAEGVLLDYLVLLPRDYYEASVLQLPVTEPCAYAGPPQENCLLYQHLPV
TRFPCTLACEARHFLLDGEPRPVAVRQPTPAHPVMVDLSGREVELHLRLRVPQVGRYVVV
LEYSTEAAQLFVADVNVKSPGSVLAGQVNIYSCKYSVLCRSAVIDHMSRIAVYELLADAD
IQLKGHMARFLLHQVCIIPIEEFSAEYVRPQVHCIASYRRFVNQSATCVSLAHETPPTAL
ILDVVSGRPFPHLPQQSSPSVDVLPGVTLKAPQNQVTLRGRAPHLGRYVFVIHFYQAAHP
TFPAQVSVDGGWPRAGSFRASFCPHVLGCRDQVIAEGQIEFDISEPEVAATVKVPEGKSL
VLVRVLMVPTENYDYQILHKKSMDKSLEFITNCGKNSFYIDPQTASRFCKNSARSLVAFY
HKGALPCECHPAGATSPHCSPEGGQCPCRPNVIGRQCTRCATGHYGFPHCKPCSCGLRLC
EEMTGQCRCPPRTVRPQCEVCETHSFSFHPMAGCEGCNCSRRGTSEAAMLQCDRDSGQCR
CKPRITGRQCDRCASGFYRFPECVPCNCNRDGTEPGVCDPGTGACLCKENVEGTECHVCR
EGSFHLDPANPKGCTSCFCFGVNNQCHSAHKRRAKFVDMLGWRLETADRMDIPVSFNPGS
NSMVADLQELPATVHSASWVAPASYLGDKVSSYGGYLTYQAKSFGLPSDMVLLEKMPDVQ
LTGQHMSVIYEETNTPRPDRLHHGRVQVVEGNFRHASSRAPVSREELMTVLSRLADMRIQ
GLYFTETQRLTLSEVGLEEASDTGSGRIAYAVEMCACPPAYAGDSCQGCSPGYYRDHKGL
YTGRCVPCNCNGHSNRCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHGSCRACPCPHT
NRFATGCVVNGGDVRCSCKAGYTGIQCERCAPGYFGNPQKFGGSCQPCSCNNNGQLGSCD
PLTGDCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQGLSASAGLLEQ
MRHMETQAKDLRNQLLNYRSTISNHGSKIEGLERELTDLNQEFETLQEKAQVNSRKAQTL
YNNVNRAIQSAKELDMKIKTVIRNVHILLKQISGPDGEGNNVPSGEFSREWAEAQRMMRE
LRNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLR
ARLQEAAARAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTSADSSLLQTNIALQ
LMEKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHAQSLQELAKQLEEI
KRNASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIKEDLPRKAKTL
SSNSDKLLNEAKMTQKKLKQEVSPALSNLQQTLNIVTVQREVIATNLTTLRDGLRGIQRG
DIDAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGSTQNEDFKKALTDADNSV
NKLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAVPMRFNGKSGV
EVRLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYIGMAVVDGQLT
CVYNLGDRETELQVDQILTESETQEAVMDRVKFQRIYQFARLNYTKGATSSKPEIPGVYD
MDGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLRFPPYKGCIELDDLNENVLSLYNFKK
TFNLNTTEVEPCRRRKEESDKNYFEGTGYARVPTQPHASIPTFGQTIQTTVDRGLLFFAE
NGDRFISLNIEDGKLMVRYKLNSEPPKERGVGDAINNGRDHSIQIKIGKVQKRMWINVDF
QNTIIDGEVFDFSTYYLGGIPIAIRERFNISTPAFRGCMKNLKKTSGVVRLNDTVGVTKK
CSEDWKLVRSASFSRGGQLSFTNLGSPLTDHLQASFGFQTFQPSGILLSHQTWTSTLQVT
LEDGHIELSTRDSGSPIFKSPQTYMDGLLHYVSVISDNSGLRLLIDDQPLRNNQRLNRIS
SSQQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLASNSLKRDVSLGGCSLNKPPFLMLLQ
GSTRFNKAKTFRINQLLQDTPVASPRSMKVWQDACSPLPRTQANHGALQFGDIPTSHLLF
KLPQELLKPRSQFAVDVQTTSSRGLVFHTGTKNSFMALYLSKGRLVFALGTDGKKLRIKS
KEKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTVSLRGPVYLGSPPSGKPKSL
PTNSFVGCLKNFQLDSKPLDTPSSSFGVSSCLGGPLEKGIYFSEEGGHVILAHSVLLGPE
FKLVFSIRPRSLTGILIHIGSQPGKHLGVYLEAGKVTASMDSGAGGTSTSVTPKQSLCDG
QWHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLTTLRIPVWKSF
FGCLRNIFVNHIPVPVTEALEVQGPVSLNGCPDH
Download sequence
Identical sequences ENSMMUP00000005791 ENSMMUP00000005793 9544.ENSMMUP00000005791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]