SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005847 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005847
Domain Number 1 Region: 17-401
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.48e-89
Family Regulator of chromosome condensation RCC1 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005847   Gene: ENSMMUG00000006405   Transcript: ENSMMUT00000006216
Sequence length 458
Comment pep:known chromosome:MMUL_1:14:53911502:54147239:1 gene:ENSMMUG00000006405 transcript:ENSMMUT00000006216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREPSASEAAPAAAVLFAWGANSYGQLGLGHKEDVLLPQQLNDFCKPRSVRRITGGGGH
SAVVTDIGDLFVCGLNKDGQLGLGHTEDIPYFTPCKSLFGCPIQQVACGWDFTIILTENG
QVLSCGSNSFGQLGVPHGPRRCVVPQAIELHKEKVVCIAAGLRHALAATASGIVFQWGTG
LASCGRRLCPGQTLPLFFTAKEPSRVTGLENSKAMCVLAGSDHSASLTDAGEVYVWGSNK
HGQLATEAAFLPVPQKIEAHCFQNEKVTAVWSGWTHLVAQTETGKVFTWGRADYGQLGRK
LETYEGWKLEKQDSFLPCSRLLNNMPSSLHCLTGATEVSCGSEHNLAVIGGVCYSWGWNE
HGMCGDGTEANIWAPKPVQALLSSSGLLVGCGAGHSLALCQLPAHPALVQDPKVTYLSPD
ATEDTESQEAMDKERNWKERQSETSTQSQSDWSRNGGL
Download sequence
Identical sequences A0A2K5UB36 A0A2K6E2P2 F7GWM5
ENSMMUP00000008447 ENSMMUP00000005847 XP_005578536.1.63531 XP_011748475.1.29376 XP_014970185.1.72884 9544.ENSMMUP00000008447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]