SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005870 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005870
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.68e-21
Family Ubiquitin-related 0.0000166
Further Details:      
 
Domain Number 2 Region: 152-203
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000176
Family UBA domain 0.00024
Further Details:      
 
Domain Number 3 Region: 228-271
Classification Level Classification E-value
Superfamily XPC-binding domain 0.000000000000209
Family XPC-binding domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005870   Gene: ENSMMUG00000004393   Transcript: ENSMMUT00000006239
Sequence length 271
Comment pep:known chromosome:MMUL_1:19:12618421:12621848:1 gene:ENSMMUG00000004393 transcript:ENSMMUT00000006239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVP
IRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPQPAARE
DKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERV
VAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQ
FQNMRQVIQQNPALLPALLQQLGQENPQLLQ
Download sequence
Identical sequences ENSMMUP00000005870 9544.ENSMMUP00000005870 ENSMMUP00000005870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]