SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005952 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005952
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-64
Family N-terminal domain of xrcc1 0.00000009
Further Details:      
 
Domain Number 2 Region: 319-403
Classification Level Classification E-value
Superfamily BRCT domain 1.74e-20
Family BRCT domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005952   Gene: ENSMMUG00000004467   Transcript: ENSMMUT00000006328
Sequence length 540
Comment pep:known chromosome:MMUL_1:19:49999857:50031645:-1 gene:ENSMMUG00000004467 transcript:ENSMMUT00000006328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI
GNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGLNPNRVRMFGPDKLVRAA
AEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDE
SANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQE
SPKGKRKLDLNQEEKKTPSKPPAQLLPSVPKRPKLPAPTSTPAAVPVPAPAQGAVTGKPR
GEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTQDSTHL
ICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSRRYLMAGPGSSSEEDEASHSGS
SGDEAPKLPRKRPQTKTKPTQATGPSLPQKPPSPEETKAASPVLQEDIDIEGEQSEGQDN
GAEDSGDTEDELRRVAEQKEHRPPPGQEENGEDPYAGSTDENTDDEEHQEPPDLPVPELP
Download sequence
Identical sequences ENSMMUP00000005952 ENSMMUP00000005952 9544.ENSMMUP00000005952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]