SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000005992 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005992
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily Gamma-glutamyl cyclotransferase-like 1.06e-41
Family Gamma-glutamyl cyclotransferase-like 0.000000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000005992   Gene: ENSMMUG00000004494   Transcript: ENSMMUT00000006369
Sequence length 153
Comment pep:known chromosome:MMUL_1:17:80876043:80932594:-1 gene:ENSMMUG00000004494 transcript:ENSMMUT00000006369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVFLYGTLKRGQPNHRVLWDGAHGSAAFRARGRTLDPYPLVIAGEHNIPWLLHLPGSG
RRVEGEVYTVDERMLRFLDDFENCPALYQRTALRVQLLEEGAPGAEEPPAPTTVQCFVYS
RATFPPEWAQLPHYDSYDSEGPHGLRYNPRENR
Download sequence
Identical sequences F7GFS1
XP_002800864.1.72884 XP_014976874.1.72884 XP_014976875.1.72884 XP_014976876.1.72884 XP_014976877.1.72884 XP_014976878.1.72884 XP_014976879.1.72884 XP_014976880.1.72884 ENSMMUP00000005992 9544.ENSMMUP00000005992 ENSMMUP00000005992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]