SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006048 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006048
Domain Number 1 Region: 45-81
Classification Level Classification E-value
Superfamily WW domain 0.0000000378
Family WW domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006048   Gene: ENSMMUG00000004548   Transcript: ENSMMUT00000006434
Sequence length 265
Comment pep:known chromosome:MMUL_1:X:46752647:46757594:1 gene:ENSMMUG00000004548 transcript:ENSMMUT00000006434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSC
GLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRG
HEKPDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHR
REELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLF
QQRPYPSPGAVLRANAEASRTKQQD
Download sequence
Identical sequences A0A096N9R2 A0A0D9RL41 A0A2K5HI76 A0A2K5P0I5 A0A2K5Y1Y4 A0A2K6CI53 G7Q2N9 H9Z3Z0
NP_001181187.1.72884 XP_005593562.1.63531 XP_005593563.1.63531 XP_005593564.1.63531 XP_007989821.1.81039 XP_007989822.1.81039 XP_007989823.1.81039 XP_007989824.1.81039 XP_011760193.1.29376 XP_011760194.1.29376 XP_011760195.1.29376 XP_011802084.1.43180 XP_011802085.1.43180 XP_011846785.1.47321 XP_011846786.1.47321 XP_011887628.1.92194 XP_011887629.1.92194 XP_011887630.1.92194 XP_014982818.1.72884 XP_014982819.1.72884 XP_014982820.1.72884 ENSPANP00000009392 ENSMMUP00000006049 ENSMMUP00000006050 9544.ENSMMUP00000006050 ENSMMUP00000006048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]