SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006165 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006165
Domain Number 1 Region: 11-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.1e-57
Family Allantoicase repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 208-388
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.51e-47
Family Allantoicase repeat 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006165   Gene: ENSMMUG00000004632   Transcript: ENSMMUT00000006554
Sequence length 410
Comment pep:known chromosome:MMUL_1:13:3161293:3205566:1 gene:ENSMMUG00000004632 transcript:ENSMMUT00000006554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADAPKEGRLTRFLDFTQLTDMASESVGGKILFATDDFFAPAENLIKSDSPCFKEREYTE
FGKWMDGWETRRKRIPGHDWCVLRLGIQGVIRAFDVDVSYFTGDYAPRMSIQAANLEEEK
LPEIPERGIRTGAAATPEEFEAIAELKSDDWSYLVPMTELKPGNPASGHNYFLVNSQQRW
THIRLNIFPDGGIARLRVLGTGQKDWTATDPKEHADLVAIAFGGVCVGFSSAKFGHPNNI
IGVGGAKSMADGWETARRLDRPPILENDDNGILLVPGCEWAVFRLAHPGVITRIEIDTKY
FKGNAPDSCKVDGCVLTTQEEEDMIKQKWILPAHKWKPLLPVTKLSPNQSHLFDSLTLEL
QDVITHARLTIVPDGGVSRLRLRGFPSSICLLRPREKPMMKFSVGFKANP
Download sequence
Identical sequences F6TE28 G8F4Y6 Q4R964
ENSMMUP00000006165 NP_001271036.1.63531 XP_001097806.1.72884 XP_014967110.1.72884 9544.ENSMMUP00000006165 ENSMMUP00000006165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]