SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006194 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006194
Domain Number 1 Region: 111-441
Classification Level Classification E-value
Superfamily Subtilisin-like 3.14e-98
Family Subtilases 0.000000000005
Further Details:      
 
Domain Number 2 Region: 435-574
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-43
Family Proprotein convertase P-domain 0.00000035
Further Details:      
 
Domain Number 3 Region: 30-100
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 2.89e-24
Family Prohormone convertase 1 pro-domain 0.0028
Further Details:      
 
Domain Number 4 Region: 585-676
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000002
Family Growth factor receptor domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006194   Gene: ENSMMUG00000004657   Transcript: ENSMMUT00000006585
Sequence length 794
Comment pep:known scaffold:MMUL_1:1099214740815:86368:92459:-1 gene:ENSMMUG00000004657 transcript:ENSMMUT00000006585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRSWLLWVVAATGTLVLLAADAQGQKVFTNTWAVHIPGGPAVANSVARKHGFLNLGQI
FGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDLYQEPTDPKFPQ
QWYLSGVTQRDLNVKEAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVGPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNH
ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPIPPESSGCKTLTSSQACVVCE
EGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETIRASVCAPCHASCATCQGPAPTDCL
SCPSHASLDPVEQTCSRQSQSSRESPPQQQPPRLPPEMEAGPRLRAGLLPSHLPEVVAGL
SCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEG
RGERTAFIKDQSAL
Download sequence
Identical sequences A0A2K6CBX3 G7MVY8 G7P9G7
9544.ENSMMUP00000006194 ENSMMUP00000006194 ENSMMUP00000006194 NP_001244671.1.72884 XP_005595531.1.63531 XP_005595532.1.63531 XP_011750503.1.29376 XP_011750504.1.29376 XP_011750505.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]