SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006232 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006232
Domain Number 1 Region: 243-312
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000379
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006232
Domain Number - Region: 302-391
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.0408
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006232   Gene: ENSMMUG00000004690   Transcript: ENSMMUT00000006623
Sequence length 490
Comment pep:known chromosome:MMUL_1:4:41514750:41522249:-1 gene:ENSMMUG00000004690 transcript:ENSMMUT00000006623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASSGWEPAPAATMASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQQLG
GPPTPAINTPVHFQSPPPVPGEVLKVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAA
HISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAPNSPMAMLHIGSNPEREFDDVIDNIMR
LDDVLGYINPEMQMPNTLPLSSSHLNVYSSDPQVTASLVGVTSSSCPADLTQKRELTDAE
SRALAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIR
RMQKDLQKSRELENHSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVV
KQELPSEEGPGEALMLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLSFGGRE
DEGPPGYPEPLAPEHGSPFPSLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRS
SFSMEEGDVL
Download sequence
Identical sequences A0A2K5LZY5 A0A2K6A510 A0A2K6CP29 F7FXN6
XP_011752881.1.29376 XP_011842073.1.47321 XP_011928836.1.92194 ENSMMUP00000030933 ENSMMUP00000006232 9544.ENSMMUP00000030933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]