SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006233 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006233
Domain Number 1 Region: 508-698
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-24
Family Fibronectin type III 0.00000322
Further Details:      
 
Domain Number 2 Region: 203-307
Classification Level Classification E-value
Superfamily Immunoglobulin 9.31e-24
Family I set domains 0.0000181
Further Details:      
 
Domain Number 3 Region: 299-412
Classification Level Classification E-value
Superfamily Immunoglobulin 1.8e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 411-511
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-19
Family I set domains 0.0097
Further Details:      
 
Domain Number 5 Region: 119-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000238
Family I set domains 0.0000282
Further Details:      
 
Domain Number 6 Region: 20-112
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000814
Family I set domains 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006233   Gene: ENSMMUG00000004688   Transcript: ENSMMUT00000006624
Sequence length 856
Comment pep:known chromosome:MMUL_1:14:111677926:111745516:1 gene:ENSMMUG00000004688 transcript:ENSMMUT00000006624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFELDFVFVLFCFVFSASLQVDIVPSQGEISVGESKFFLCQGKGDAKDKDISWFSPNGEK
LTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFK
NAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKK
TDEGTYRCEGRILARGEINFKDIQVVVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFP
EPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIH
LKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEK
QETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGP
VAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSE
NDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPIL
KYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAAS
EFKTQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRL
PSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLSTG
AIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFSKD
ESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVK
TVPNDATQTKENESKA
Download sequence
Identical sequences ENSMMUP00000006233 ENSMMUP00000006233 9544.ENSMMUP00000006233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]