SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006291 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006291
Domain Number 1 Region: 120-219
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.92e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000188
Further Details:      
 
Domain Number 2 Region: 262-334
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.21e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 329-405
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.34e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000083
Further Details:      
 
Domain Number 4 Region: 655-731
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000854
Further Details:      
 
Domain Number 5 Region: 411-514
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.32e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 6 Region: 38-115
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.43e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000114
Further Details:      
 
Domain Number 7 Region: 550-601,631-654
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 8 Region: 1-45
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000076
Family Eukaryotic type KH-domain (KH-domain type I) 0.0069
Further Details:      
 
Domain Number 9 Region: 733-771
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000103
Family Eukaryotic type KH-domain (KH-domain type I) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006291   Gene: ENSMMUG00000004730   Transcript: ENSMMUT00000006686
Sequence length 849
Comment pep:known chromosome:MMUL_1:12:105151559:105164311:-1 gene:ENSMMUG00000004730 transcript:ENSMMUT00000006686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKANSFTVSSVAAPSWLHR
FIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDY
VEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKREL
LELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLR
GPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDL
PAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIR
SIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPE
YHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNL
DNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVE
AAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDREENPV
HSAEPVVQENGDEAGEGREAKDSDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEV
EVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLER
VKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDAIDHILNLEEEYLA
DVVDSEVLQVYMKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGAQVAP
KTLPWGPKR
Download sequence
Identical sequences ENSMMUP00000006291 ENSMMUP00000006293 9544.ENSMMUP00000006293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]