SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006328 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006328
Domain Number 1 Region: 50-178
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 2.62e-58
Family N-terminal domain of cbl (N-cbl) 0.000000168
Further Details:      
 
Domain Number 2 Region: 265-351
Classification Level Classification E-value
Superfamily SH2 domain 2.09e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 357-435
Classification Level Classification E-value
Superfamily RING/U-box 8.17e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 179-264
Classification Level Classification E-value
Superfamily EF-hand 2.14e-38
Family EF-hand modules in multidomain proteins 0.00000543
Further Details:      
 
Domain Number 5 Region: 842-894
Classification Level Classification E-value
Superfamily UBA-like 0.00000766
Family UBA domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006328   Gene: ENSMMUG00000004761   Transcript: ENSMMUT00000006725
Sequence length 907
Comment pep:known chromosome:MMUL_1:14:117615420:117712782:1 gene:ENSMMUG00000004761 transcript:ENSMMUT00000006725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNVKKSSGAGGGGGSGGSGSGGLIGLMKDAFQPHHHHHHHHLSPHPPGTVDKKMVEKC
WKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFM
ENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTF
RITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVF
EFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTR
LGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQD
HIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFC
RCEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVE
RPPSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTL
RDLPPPPPPDRPYSVGTESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVP
VSAPSSSDPWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSMNSSPLVGPEC
DHPKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRA
CDCDQQIDTCTYEAMYNIQSQAPSVTESSTFGEGSLAAAHANTGPEEPENEDDGYDVPKP
PVPAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEVSQVPERPPKPFPRRINSERKAGS
WQQGSGAAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSIS
SPAHVAT
Download sequence
Identical sequences A0A1D5RFE7 A0A2K5X0C9
ENSMMUP00000006328 ENSMMUP00000006328 NP_001245076.1.72884 XP_005579973.1.63531 9544.ENSMMUP00000006328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]