SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006339 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006339
Domain Number 1 Region: 90-155
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.09e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006339   Gene: ENSMMUG00000004770   Transcript: ENSMMUT00000006737
Sequence length 237
Comment pep:known chromosome:MMUL_1:6:131965384:131966097:-1 gene:ENSMMUG00000004770 transcript:ENSMMUT00000006737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAPLETCISDLDCASSSGSDLSGFLTDEEDCTRLQQAASASGPPVPARRGAPNISRASE
VPGAQDDEQERRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLP
SFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGSARERLLPPQCVPCLPGPPSPA
SDAESWGSGAAAASPLSDPSSPAASEDFTYGPSEPAFSFSSLPKDLLHTTPCFIPYH
Download sequence
Identical sequences A0A2K6AU39 F6SM19
XP_001110622.1.72884 XP_011714824.1.29376 ENSMMUP00000006339 ENSMMUP00000006339 9544.ENSMMUP00000006339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]