SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006347 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006347
Domain Number 1 Region: 133-458
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.69e-39
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000022
Further Details:      
 
Domain Number 2 Region: 462-555
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000134
Family Ricin B-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006347   Gene: ENSMMUG00000004777   Transcript: ENSMMUT00000006746
Sequence length 557
Comment pep:known chromosome:MMUL_1:14:60301531:60633920:1 gene:ENSMMUG00000004777 transcript:ENSMMUT00000006746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRGQEPAPDKKLEEDKGDTL
KIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHWGQELSPEGRRVALKQFQYY
GYNAYLSDRLPLDRPLPDLRPSGCRNLSFPDSLPEVSIVFIFVNEALSVLLRSIHSAIER
TPPHLLKEIILVDDNSSNEELKEKLTEYVDKVNSQKPGFIKVVRHSKQEGLIRSRVSGWR
AATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSFDNIKYDNFEIEEYPLAAQGF
DWELWCRYLNPPKAWWKLENSTAPIRNPLLAQCLFSNLSPIVGMTGVGRVERNCSLIFNG
IQVWQCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMAWN
IPQEDSGIDIGDITARKALRKQLQCKTFRWYLVSVYPEMRMYSDIIAYGVLQNSLKTDLC
LDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRLIE
CSYAKAKRMKLHWQFSQ
Download sequence
Identical sequences ENSMMUP00000006347 ENSMMUP00000006347 9544.ENSMMUP00000006347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]