SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006351 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006351
Domain Number 1 Region: 650-845
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000414
Further Details:      
 
Domain Number 2 Region: 466-577
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-19
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 3 Region: 11-94
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000387
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 4 Region: 259-298
Classification Level Classification E-value
Superfamily WW domain 0.00000000994
Family WW domain 0.0022
Further Details:      
 
Domain Number 5 Region: 363-391
Classification Level Classification E-value
Superfamily WW domain 0.0000208
Family WW domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006351   Gene: ENSMMUG00000004778   Transcript: ENSMMUT00000006751
Sequence length 847
Comment pep:known chromosome:MMUL_1:9:31974515:32098661:-1 gene:ENSMMUG00000004778 transcript:ENSMMUT00000006751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMADRSGKIIPGQVYIEVEYDYEYEAKDRKIVIKQGERYILVKKTNDDWWQVKPDENSK
AFYVPAQYVKEVTRKALMPPVKQVAGLPNNSTKIMQSLHLQRSTENVNKLPELSSFGKPS
SSVQGTGLTRDANQNFGPSYNPGHTVNLSLDLTHNNGKFNNDSHSPKVSSQNRTRLFGHF
PGPEFLDVEKTSFSQEQSCDSAGEGSERIHQDSESGDELSSSSTEQIRATTPPNQGRPDS
PVYANLQELKISQSALPPLPGSPAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTR
DASISKGDFQSPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYT
NEKWLKHIDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKW
RHSTIVLDTNDKESPTASKPCFPENESSPSSPKHQDTASSPKDQEKYGLLNVTKIAENGK
KVRKNWLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGATIEMASKDKSSKK
NVFELKTRQGTELLIQSDNDTVINDWFKVLSSTINNQAVDTDEGIEEEILPDSPGIEKHD
KEKEQKDPKKLRSFKVSSIDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIKDQVFGSNLA
NLCQRENGTVPKFVKLCIEHVEEYGLDVDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSK
WEDIHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQRVAAVKDLIRQLPKPNQDT
MQILFRHLKRVVENGEKNRMTYQSIAIVFGPTLLKPEKETGNIAVHTVYQNQIVELILLE
LSSIFGR
Download sequence
Identical sequences A0A2I3LGV7 A0A2K5WAC3 A0A2K6AP36 H9G211
ENSMMUP00000006351 9544.ENSMMUP00000006350 ENSMMUP00000006350 NP_001247728.1.72884 XP_005564973.1.63531 XP_011736570.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]