SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006382 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006382
Domain Number 1 Region: 27-535
Classification Level Classification E-value
Superfamily ARM repeat 2.53e-94
Family Clathrin adaptor core protein 0.0011
Further Details:      
 
Domain Number 2 Region: 601-759
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 4.6e-64
Family Coatomer appendage domain 0.000000213
Further Details:      
 
Domain Number 3 Region: 760-870
Classification Level Classification E-value
Superfamily Subdomain of clathrin and coatomer appendage domain 1.49e-33
Family Coatomer appendage domain 0.00000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006382   Gene: ENSMMUG00000004801   Transcript: ENSMMUT00000006786
Sequence length 871
Comment pep:known chromosome:MMUL_1:3:167897824:168036012:-1 gene:ENSMMUG00000004801 transcript:ENSMMUT00000006786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEH
FGTTEATEAFFAMTRLFQSNDQTLRRMCYLTIKEMATISEDVIIVTSSLTKDMTGKEDVY
RGPAIRALCRITDGTMLQAIERYMKQAIVDKVSSVSSSALVSSLHMMKISYDVVKRWINE
AQEAASSDNIMVQYHALGVLYHLRKNDRLAVSKMLNKFTKSGLKSQFAYCMLIRIASRLL
KETEDGHESPLFDFIESCLRNKHEMVIYEAASAIIHLPNCTARELAPAVSVLQLFCSSPK
PALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGSESSVDRL
MKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEYKRAIVDC
IISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYIRFIFNRV
VLENEAVRAAAVSALAKFGAQNESLLPSILVLLQRCMMDTDDEVRDRATFYLNVLQQRQV
ALNATYIFNGLTVSVPGMEKALHQYTLEPSEKPFDMKSIPLAMAPVFEQKAEITFVATKP
EKLAPSRQDIFQEQLAAIPEFLNIGPLFKSSEPVQLTEAETEYFVRCIKHMFTNHIVFQF
DCTNTLNDQLLEKVTVQMEPSDSYEVLCCIPAPSLPYNQPGICYTLVRLPDDDPTAVAGT
FSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTF
EKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGCDLLVR
SRLALADGVTMQVTVRSKERTPVDVILASVG
Download sequence
Identical sequences A0A2K5U893 F6S6K6
ENSMMUP00000006382 9544.ENSMMUP00000006382 XP_005550843.1.63531 XP_014990407.1.72884 ENSMMUP00000006382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]