SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006398 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006398
Domain Number 1 Region: 3-144
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.74e-57
Family ENTH domain 0.000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006398   Gene: ENSMMUG00000004811   Transcript: ENSMMUT00000006802
Sequence length 576
Comment pep:known chromosome:MMUL_1:19:61707339:61729500:1 gene:ENSMMUG00000004811 transcript:ENSMMUT00000006802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMI
WKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQG
VNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQS
SGEEELQLQLALAMSKEEADQPPSCGPEDDAQLQLALSLSREEHDKEERIRRGDDLRLQM
AIEESKRETGGKEESSLMDLADVFTAPAPPPTTDPWGGPAPVAAAVPTAAPTSDPWGGPP
VPPAADPWGGPAPTPASGDPWRPAAPAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPV
SGPSASDPWTPAPAFSDPWGGSPAKPSTNGTTASGGFDTEPDEFSDFDRLRTALPTSGSS
AGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSPQPAATPTPTPPTRKTPESFLGPNAA
LVDLDSLVSRPGPTPSGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSPVPP
VPGAPPTYISPLGGGPGLPPMMPPGPPAPNTNPFLL
Download sequence
Identical sequences ENSMMUP00000006398 ENSMMUP00000006399 9544.ENSMMUP00000006399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]