SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006475 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006475
Domain Number 1 Region: 2-43
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000531
Family Chromo domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006475   Gene: ENSMMUG00000004870   Transcript: ENSMMUT00000006883
Sequence length 397
Comment pep:known chromosome:MMUL_1:10:82779858:82785605:-1 gene:ENSMMUG00000004870 transcript:ENSMMUT00000006883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGPKPKTFLLK
ARAQAEALRISDVHFSVKPTASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGG
SPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGTGQGAGALARPKV
PSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPSAPLAAPPAPLAAPPAGKADASAP
GPGLLLAAPATPYDARSSGSSGCPSPAPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDL
SLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGASSEPEAGDWRPEMSPCSNVVVTDVTS
NLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSSGASK
Download sequence
Identical sequences 9544.ENSMMUP00000006475 ENSMMUP00000006475 ENSMMUP00000006475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]