SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006486 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006486
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily ENTH/VHS domain 4.36e-53
Family ENTH domain 0.00000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006486   Gene: ENSMMUG00000004879   Transcript: ENSMMUT00000006894
Sequence length 608
Comment pep:known chromosome:MMUL_1:10:83676567:83825052:-1 gene:ENSMMUG00000004879 transcript:ENSMMUT00000006894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRRQVKNFVKNYSDAEIKVREATSNDPWGPSSSLMLDISDLTFNTISLSEIMNMLWHR
LNDHGKNWRHVYKSLTLMDYLIKNGSKKVVQHCREGFCNLQTLKDFQHIDEAGKDQGYYV
REKSKQVITLLMDEQLLCKEREVACRTRQRTSYSMLFSKRPLGSSSSLTARTSAPTSDIS
ASEKKCKLPKFGRLRNKKNVCKAELKQEHCQDLHLPTETMLSQETLPLKIHGWKSTEDLM
TFSDDDPKLPLLATPPSIVSPITCLSEAAEVCNLLGADAVPTVSENSPSGQTDVSLDKRS
DGTLTNTVTENLLETPLEKQSAAEGLKTLTILPACWSSSKEEFISPNLRISKSNSTFHNQ
ASVETLYLSPSFKIFDPAKETVINKACQKPPQSSIQMDDKILKTTTWVSTASEGASSFSP
LSMSSPDLASPEKSAHLLSPILAGPSFWTLSHQQLSSTSFKEEDKTTKLHHSFASRGPVS
SDAEENDSLNLLGILPNNSDSAKKNVSHISSRHWGEFSTQNVDQFIPLSCSGFQSTKDFP
REPEAENSISVLLREVKCAIARLHEDLSTVIQELNVINNHLMSMSLNSSQISQSSQAPQS
SEGSSDQI
Download sequence
Identical sequences F7AN62 G7PFL3
XP_001099911.1.72884 9544.ENSMMUP00000006486 ENSMMUP00000006486 ENSMMUP00000006486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]