SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006559 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006559
Domain Number 1 Region: 110-175
Classification Level Classification E-value
Superfamily Chromo domain-like 3.26e-26
Family Chromo domain 0.0000561
Further Details:      
 
Domain Number 2 Region: 14-74
Classification Level Classification E-value
Superfamily Chromo domain-like 4.34e-23
Family Chromo domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006559   Gene: ENSMMUG00000004950   Transcript: ENSMMUT00000006977
Sequence length 191
Comment pep:known chromosome:MMUL_1:11:51344283:51364918:-1 gene:ENSMMUG00000004950 transcript:ENSMMUT00000006977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCP
ELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERG
LEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPED
AENKEKETAKS
Download sequence
Identical sequences A0A091CSL1 A0A0D9QZG1 A0A1U7TLR6 A0A212DF96 A0A250YBI4 A0A2I3LLL9 A0A2K5MPW2 A0A2K5QBE6 A0A2K5WBV7 A0A2K6ECP8 A0A2K6G9A8 A0A2K6QYW9 A0A2K6THI9 F2Z4J7 F2Z5T3 F6UM66 F7C841 F7IG39 G1S7F7 G3QCU2 G5BID8 I3MNC5 K7AP88 L8I9B4 L8Y296 P45973 V9HWG0
ENSPANP00000000701 gi|188035908|ref|NP_001120793.1| gi|188035910|ref|NP_001120794.1| gi|6912292|ref|NP_036249.1| ENSCJAP00000035012 ENSMMUP00000006559 ENSMMUP00000039510 ENSSSCP00000000298 ENSECAP00000006177 ENSTBEP00000007000 ENSMICP00000004948 NP_001120793.1.87134 NP_001120793.1.92137 NP_001120794.1.87134 NP_001120794.1.92137 NP_001180142.1.59421 NP_001180142.1.76553 NP_001253841.1.72884 NP_036249.1.87134 NP_036249.1.92137 XP_001504609.1.31192 XP_002752593.1.60252 XP_002752595.1.60252 XP_003252930.1.23891 XP_003252931.1.23891 XP_003339276.1.37143 XP_003365300.1.31192 XP_003807628.1.60992 XP_003807629.1.60992 XP_003807630.1.60992 XP_003939308.1.74449 XP_003939309.1.74449 XP_004053323.1.27298 XP_004053324.1.27298 XP_004053325.1.27298 XP_004872844.1.39548 XP_004872845.1.39548 XP_004872846.1.39548 XP_005206221.1.76553 XP_005206222.1.76553 XP_005206223.1.76553 XP_005325129.1.77405 XP_005325131.1.77405 XP_005571129.1.63531 XP_005571130.1.63531 XP_005663906.1.46622 XP_005679910.1.57651 XP_005679911.1.57651 XP_005679912.1.57651 XP_005679913.1.57651 XP_005679915.1.57651 XP_005902151.1.15283 XP_005902152.1.15283 XP_005902153.1.15283 XP_005954442.1.78601 XP_005954443.1.78601 XP_005954444.1.78601 XP_006063774.1.26621 XP_006063775.1.26621 XP_006063776.1.26621 XP_006063777.1.26621 XP_006063778.1.26621 XP_008001697.1.81039 XP_008001698.1.81039 XP_008001699.1.81039 XP_008001700.1.81039 XP_008058780.1.4292 XP_008525961.1.77740 XP_008525969.1.77740 XP_008525978.1.77740 XP_008574389.1.73410 XP_008574396.1.73410 XP_008574404.1.73410 XP_008574410.1.73410 XP_009002148.1.60252 XP_010372172.1.97406 XP_010607672.1.5607 XP_010607673.1.5607 XP_010607674.1.5607 XP_010607675.1.5607 XP_010607676.1.5607 XP_010856269.1.44457 XP_010856270.1.44457 XP_010856271.1.44457 XP_011727028.1.29376 XP_011727029.1.29376 XP_011903366.1.92194 XP_011903367.1.92194 XP_011903368.1.92194 XP_012365751.1.23891 XP_012507861.1.63892 XP_012507868.1.63892 XP_012619796.1.48125 XP_012619805.1.48125 XP_012619811.1.48125 XP_012619815.1.48125 XP_012619826.1.48125 XP_012619830.1.48125 XP_012619836.1.48125 XP_012619843.1.48125 XP_012619850.1.48125 XP_013853036.2.46622 XP_014439876.1.99106 XP_014439877.1.99106 XP_014439878.1.99106 XP_014439879.1.99106 XP_014439880.1.99106 XP_014439881.1.99106 XP_014596330.1.31192 XP_014596332.1.31192 XP_014642050.1.5094 XP_014642051.1.5094 XP_014692003.1.49734 XP_014692012.1.49734 XP_014692020.1.49734 XP_014692030.1.49734 XP_015007293.1.72884 XP_015007294.1.72884 XP_015286472.1.63531 XP_016778771.1.37143 XP_017357363.1.71028 XP_017357364.1.71028 XP_017534085.1.32401 XP_017534086.1.32401 XP_017534087.1.32401 XP_017534088.1.32401 XP_018893930.1.27298 XP_019815951.1.53367 XP_019815952.1.53367 XP_019815953.1.53367 XP_019815954.1.53367 XP_019815957.1.53367 XP_020019663.1.5219 XP_020750784.1.74333 XP_020750785.1.74333 XP_020750786.1.74333 XP_020750787.1.74333 XP_020750788.1.74333 XP_020750789.1.74333 XP_020750790.1.74333 XP_020947399.1.46622 XP_020947401.1.46622 XP_020947402.1.46622 XP_020947403.1.46622 XP_021581905.1.77405 XP_522411.2.37143 GO.39309 HR6508 HGL_H00000411524 ENSP00000209875 ENSNLEP00000021446 ENSTBEP00000007000 ENSPTRP00000008567 ENSP00000209875 ENSP00000401009 ENSP00000449207 ENSMMUP00000006559 ENSNLEP00000021446 ENSECAP00000006177 ENSCJAP00000035012 ENSCJAP00000035016 ENSCJAP00000035019 9544.ENSMMUP00000006559 9598.ENSPTRP00000008567 9606.ENSP00000209875 9796.ENSECAP00000006177 9823.ENSSSCP00000000298 9913.ENSBTAP00000008198 ENSP00000209875 ENSP00000401009 ENSP00000449207 ENSBTAP00000008198 ENSPTRP00000008567 ENSGGOP00000000040 ENSMICP00000004948 ENSBTAP00000008198 ENSSSCP00000000298 ENSSTOP00000013142 ENSGGOP00000000040 ENSSTOP00000013142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]