SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006579 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006579
Domain Number 1 Region: 281-524
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.78e-56
Family Crotonase-like 0.00000000985
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily Chromo domain-like 6.47e-18
Family Chromo domain 0.0000999
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006579   Gene: ENSMMUG00000004964   Transcript: ENSMMUT00000006998
Sequence length 537
Comment pep:known chromosome:MMUL_1:4:4764358:4829427:1 gene:ENSMMUG00000004964 transcript:ENSMMUT00000006998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVERIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHTEKQKEST
LTRTNRTSPNNARKQISRSTNSNFSKTSPKALVIGKDHESKNSQLFAASQKFRKNTAPSL
SSRKNMDLAKSGIKILVPKSPIKSRTAVDGFQSESPEKLDPIEQGQEDTVAPEVAAEKPV
GALLGPGAERARMGSRPRIHPLVPQVPGPVTAAMATGLAVNGKGTSPFMDALTANGTTSI
QTSVTAVTASKRKFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTHILLSTKS
SENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKREST
KMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQS
PDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELA
SCNPVVLEESKALVRCNMKMELEQANERECEALKKIWGSAQGMDSMLKYLQRKIDEF
Download sequence
Identical sequences ENSMMUP00000006579 9544.ENSMMUP00000006579 ENSMMUP00000006579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]