SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006643 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006643
Domain Number 1 Region: 32-72
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000017
Family SNARE fusion complex 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006643   Gene: ENSMMUG00000005016   Transcript: ENSMMUT00000007070
Sequence length 134
Comment pep:known chromosome:MMUL_1:1:3146944:3187574:1 gene:ENSMMUG00000005016 transcript:ENSMMUT00000007070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE
AMRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTV
IKYLPGPLQDMLKK
Download sequence
Identical sequences A0A096N892 A0A0D9RS50 A0A2I3RFH1 A0A2J8SSD4 A0A2K5J135 A0A2K5MJC5 A0A2K5PTK4 A0A2K5Z4Q2 A0A2K6DHZ8 A0A2K6MJ24 A0A2K6NPH4 G3S2L5 H9FP10 Q4R4N1
NP_001244613.1.72884 NP_001271686.1.63531 XP_004038355.1.27298 XP_008016384.1.81039 XP_008961967.1.60992 XP_008991998.2.60252 XP_010373625.1.97406 XP_011743094.1.29376 XP_011792187.1.43180 XP_011792188.1.43180 XP_011826293.1.47321 XP_011914725.1.92194 XP_015305472.1.63531 XP_016806597.1.37143 XP_016806598.1.37143 XP_017394432.1.71028 XP_017720908.1.44346 XP_018880741.1.27298 XP_018880742.1.27298 XP_018880743.1.27298 XP_018880744.1.27298 ENSMMUP00000006643 ENSMMUP00000006643 9544.ENSMMUP00000006643 ENSPANP00000008818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]