SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006719 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006719
Domain Number 1 Region: 3-220
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.31e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0099
Further Details:      
 
Domain Number 2 Region: 168-332
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.46e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.021
Further Details:      
 
Domain Number 3 Region: 311-487
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000906
Family FAD/NAD-linked reductases, N-terminal and central domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006719   Gene: ENSMMUG00000005069   Transcript: ENSMMUT00000007150
Sequence length 533
Comment pep:known chromosome:MMUL_1:1:200972815:201001074:1 gene:ENSMMUG00000005069 transcript:ENSMMUT00000007150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVS
NSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFNLLKHIQFKTKVCSVTKCSDFT
VSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFSALVNSQQGDYFHSRQYKHP
DIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRF
QNMLRNSLPTPIVTWLMVRKINNWLNHANYGLIPEERTQLKEFVLNDELPGRIITGKVFI
RPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPA
HLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARRENKPSW
FGLCYCKALQSDYITYIDELLTYINAKPKLFSMLLTDPHLALTVFFGPCSPYQFRLTGPG
KWEGARNAIMTQWDRTFKVTKGRVVQESPSPFESFLKLFSFLALLVAIFLIVL
Download sequence
Identical sequences ENSMMUP00000006719 ENSMMUP00000006719 9544.ENSMMUP00000006719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]