SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006770 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006770
Domain Number 1 Region: 7-77,160-249,288-368
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.63e-55
Family Regulator of chromosome condensation RCC1 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006770   Gene: ENSMMUG00000005108   Transcript: ENSMMUT00000007204
Sequence length 376
Comment pep:known scaffold:MMUL_1:1099214740815:2627:8018:-1 gene:ENSMMUG00000005108 transcript:ENSMMUT00000007204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEERPGAWFGFGFCGFGQELGSGRGHQVHSPSPLRAGVDVCRVSASWSYTAFVTRGGRV
ELSGSASGAAGGCRDAWASEGLLLVLRAGPGPEALLQAWAPDSALRGEPLWAHNVVPEAV
EEDDPGGEAQIGRLPLLPCARAYVSPRPPFYRPLAPQLRARQLELGAEHALLLDAAGQVF
SWGGGRHGQLGHGTLEAELEPRLLEALQGLTMAEVAAGGWHSVCVSETGDIYIWGWNESG
QLALPTRNLAEDGETVAREATGLNEDGSQVKRTGRVEDGAPAPFIAVQPFPALLDLPLGS
DAVKVSCGSRHTAVVTRTGELYTWGWGKYGQLGHEDTTSLDWPRRVEYFVDKQLQVKTVT
CGPWNTYVYAVEKGKS
Download sequence
Identical sequences ENSMMUP00000006770 NP_001180861.1.72884 XP_014998489.1.72884 XP_014998490.1.72884 XP_014998491.1.72884 XP_014998492.1.72884 ENSMMUP00000006770 9544.ENSMMUP00000006770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]