SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006801 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006801
Domain Number 1 Region: 120-453
Classification Level Classification E-value
Superfamily Subtilisin-like 1.44e-87
Family Subtilases 0.00000000197
Further Details:      
 
Domain Number 2 Region: 454-599
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-23
Family Proprotein convertase P-domain 0.0005
Further Details:      
 
Domain Number 3 Region: 31-103
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.53e-22
Family Prohormone convertase 1 pro-domain 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006801   Gene: ENSMMUG00000005134   Transcript: ENSMMUT00000007236
Sequence length 749
Comment pep:known chromosome:MMUL_1:6:92594019:92633476:-1 gene:ENSMMUG00000005134 transcript:ENSMMUT00000007236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRAWTLQCTAFALFCAWCALNSAKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERTKRSAIKDSAQNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPSTMN
KAILYAIRTLASSCKGTNSVSKSLWIIHYFSTIFIEANNIIHYYICQAIGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPVGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENTLVSKSPSSSSIGGQRDELEEGAPS
EAMLRLLQSAFSKNSPPKQSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDY
VDVFYNTKPYKHRDDRLLQALVDILNEEN
Download sequence
Identical sequences 9544.ENSMMUP00000006801 ENSMMUP00000006801 ENSMMUP00000006801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]