SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006846 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006846
Domain Number 1 Region: 1229-1408
Classification Level Classification E-value
Superfamily Fibronectin type III 3.73e-33
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 2 Region: 995-1134
Classification Level Classification E-value
Superfamily Fibronectin type III 3.69e-31
Family Fibronectin type III 0.00097
Further Details:      
 
Domain Number 3 Region: 727-887
Classification Level Classification E-value
Superfamily Fibronectin type III 5.84e-25
Family Fibronectin type III 0.00064
Further Details:      
 
Domain Number 4 Region: 527-625
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-21
Family I set domains 0.05
Further Details:      
 
Domain Number 5 Region: 63-151
Classification Level Classification E-value
Superfamily Immunoglobulin 5.19e-21
Family I set domains 0.02
Further Details:      
 
Domain Number 6 Region: 1135-1234
Classification Level Classification E-value
Superfamily Immunoglobulin 6.53e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 7 Region: 435-531
Classification Level Classification E-value
Superfamily Immunoglobulin 4.86e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 8 Region: 246-344
Classification Level Classification E-value
Superfamily Immunoglobulin 8.18e-18
Family I set domains 0.035
Further Details:      
 
Domain Number 9 Region: 346-438
Classification Level Classification E-value
Superfamily Immunoglobulin 2.21e-17
Family I set domains 0.04
Further Details:      
 
Domain Number 10 Region: 626-731
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 11 Region: 147-239
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000248
Family I set domains 0.032
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006846
Domain Number - Region: 8-59
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0231
Family I set domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006846   Gene: ENSMMUG00000005174   Transcript: ENSMMUT00000007287
Sequence length 1862
Comment pep:known chromosome:MMUL_1:3:6289899:6617956:1 gene:ENSMMUG00000005174 transcript:ENSMMUT00000007287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSLFSCISGSRFLITSTGALYIKDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVSDPA
NSAPSILDGFDHRKAMAGQRVELPCKALGHPEPDYRWLKDNMPLELSGRFQKTVTGLLIE
NIRPSDSGSYVCEVSNRYGTAKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCTVTGTE
DQELSWYRNGEILNPGKNVRITGINHENLIMDHMVKSDGGAYQCFVRKDKLSAQDYVQVV
LEDGTPKIISAFSEKVVSPAEPVSLMCNVKGTPLPTITWTLDDDPILKGGSHRISQMITS
EGNVVSYLNISSSQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDT
YIHCRVIGYPYYSIKWYKNSNLLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQP
QLSTSQSVHVTVKVPPFIQPFEFPRFSIGQRVFIPCVVVSGDLPITITWQKDGRPIPGSL
GVTIDNIDFTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFVVQPRDQDG
IYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDS
GYYLCKVSNDVGADVSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRW
EKEDRIINPEMARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLT
VQDGAEPPDPPEIEIKDVKARTITLRWTMGFDGNSPITGYDIECKNKSEKQNPKDSWDSA
QRTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKSEPSNELTITADEAAPDGPPQEVH
LEPISSQSIRVTWKVGWKEMLSGTVRSFTLKYSIKSTGLNFRKLDTTPISTPNQNDLNNL
IYLAKMTKAATIMHVTDAAHSFTSATQFVSTLTLSSYITLPPEHADPVVCWVEAVIPSWP
QLNSALQIQLLRGRRVTAFSYISDGELGEIKNITTTQPSLELDGLEKYTNYSIQVLAFTR
AGDGVRSEQIFTRTKEDVPGPPAGVKAAAASASMVFVSWLPPLKLNGIIRKYTVFCSHPY
PTVISEFEASPDSFSYRIPNLSRNRQYSVWVVAVTSAGRGNSSEIITVEPLAKAPARILT
FSGTVTTPWMKDIVLPCKAVGDPSPAVKWMKDSNGTPSLVTIDGRRSIFSNGSFIIRTVK
AEDSGYYSCIANNNWGSDEIILNLQVQVPPDQPRLTVSKTTSSSITLSWLPGDNGGSSIR
GYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKT
LGKEPQFSKEQELFASINTTRVRLNLIGWNDGGCPITSFTLEYRPFGTTVWTTAQRTSLS
KSYILYDLQEATWYELQMRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQSEEGLTTN
EGLKMLVTISCILVGVLLLFVLLLVVRRRRREQRLKRLRDAKSLAEMLMSKNTRTSDTLS
KQQQTLRMHIDIPRAQLLIEERDTMETIDDRSTVLLTDADFGEAAKQKSLTVTHTVHYQS
VSQATGPLVDVSDARPGTNPTTRRNAKAGPTARNRYASQWTLNRPHPTISAHTLTTDWRL
PTPRATGSVDKESDSYSVSPSQDTDRARSSMVSTESASSTYEELARAYEHAKMEEQLRHA
KFTITECFISDTSSEQLTAGTNEYTDSLTSSTPSESGICRFTASPPKPQDGGRVMNMAVP
KAHRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQKSRTLKRPTVLEPIPMEA
ASSASSTREGQSWQPGAVATLPQREGAELGQAAKMSSSQESLLDSRGHLKGNNPYAKSYT
LV
Download sequence
Identical sequences 9544.ENSMMUP00000006849 ENSMMUP00000006846 ENSMMUP00000006849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]