SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006871 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006871
Domain Number 1 Region: 322-492,532-617,660-688,749-856
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.28e-86
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00061
Further Details:      
 
Domain Number 2 Region: 175-283
Classification Level Classification E-value
Superfamily RING/U-box 2.24e-37
Family Zf-UBP 0.000000665
Further Details:      
 
Domain Number 3 Region: 710-767
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000108
Family UBA domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006871   Gene: ENSMMUG00000005192   Transcript: ENSMMUT00000007312
Sequence length 858
Comment pep:known chromosome:MMUL_1:11:7033521:7048194:1 gene:ENSMMUG00000005192 transcript:ENSMMUT00000007312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVER
HFNKTGQRVYLHLRRTRRLKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FSLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHYRET
GYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESGVPLKPLFGPGYTGIQNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKMPLPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVI
IQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAAA
DPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRSA
ADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS
EKPPKDLGYIYFYQRVAS
Download sequence
Identical sequences A0A096NXI9 A0A2K5MJE7 A0A2K6AES3 F7CT78 G7PJN7
XP_005570025.1.63531 XP_011743933.1.29376 XP_011838386.1.47321 XP_011909741.1.92194 XP_015006309.1.72884 9544.ENSMMUP00000006871 ENSMMUP00000006871 ENSMMUP00000006871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]