SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006924 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006924
Domain Number 1 Region: 776-967
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.29e-65
Family I/LWEQ domain 0.000000214
Further Details:      
 
Domain Number 2 Region: 41-155
Classification Level Classification E-value
Superfamily ENTH/VHS domain 3.92e-24
Family Phosphoinositide-binding clathrin adaptor, N-terminal domain 0.046
Further Details:      
 
Domain Number 3 Region: 220-290
Classification Level Classification E-value
Superfamily ARM repeat 0.0000978
Family Mo25 protein 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006924   Gene: ENSMMUG00000005229   Transcript: ENSMMUT00000007366
Sequence length 1039
Comment pep:known chromosome:MMUL_1:3:50543892:50753109:1 gene:ENSMMUG00000005229 transcript:ENSMMUT00000007366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRMASSMKQVPNPLPKVLSRRGVGAGLEAAERESFERTQTVSINKAINTQEVAVKEKHA
RNILLDTQTSKGAQTFWSVVNRLPLSSNAVLCWKFCHVFHKLLRDGHPNVLKDFLRYRNE
LSDMSRMWGHLSEGYGQLCSIYLKLLRTKMEYHTKNPRFPGNLQMSDRQLDEAGESDVNN
FFQLTVEMFDYLECELNLFQTVFNSLDMSRSVSVTAAGQCRLAPLIQVILDCSHLYDYTV
KLLFKLHSCLPADTLQGHRDRFMEQFTKLKELFYRSSNLQYFKRLIQIPQLPENPPNFLR
ASALSEHISPVVVIPAETSSPDSEPVLEKDDLMDMDASQQSLFDNKFDDIFGSSFSSDPF
NFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGRVSELEAELAEQQ
HLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIERKAQANEQRYSKLKEKYSELVQ
NHADLLRKNAEVTKQVSMARQAQVDLEREKKQLEDSLERISDQGQRKTQEQLEVLESLKQ
ELATSQRELQVLQGSLETSAQSEANWAAQIAELEKERDSLVSGAAHRDEELSALRRELQD
TQLKLASTEASESMCQLAKDQRKMLLVGSRKAAEQVIQDALNQLEEPPLISCAGSADHLL
STVTSISSCTEQLEKSWSQYLACPEDISGLLHSITLLAHLTSDAISHGASTSLRAPPEPA
DSLTEACKQYGRETLAYLAALEEEGTLENADSTAMRNCLSKIKAIGEELLPRGLDIKQEE
LGDLVDKEMAATSAAIETATARIEEMLSKSRAGDTGVKLEVNERILGCCTSLMQAIQVLI
VASKDLQREIVESGRGTASPKEFYAKNSRWTEGLISASKAVGWGATVMVDAADLVVQGRG
KFEELMVCSHEIAASTAQLVAASKVKADKDSPNLAQLQQASRGVNQATAGVVASTISGKS
QIEETDNMDFSSMTLTQIKRQEMDSQVRVLELENELQKERQKLGELRKKHYELAGVAEGW
EEGTEASPPTLQEAVTEKE
Download sequence
Identical sequences ENSMMUP00000006924 9544.ENSMMUP00000006924 ENSMMUP00000006924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]