SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006936 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006936
Domain Number 1 Region: 13-57
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000000579
Family Chromo domain 0.00088
Further Details:      
 
Domain Number 2 Region: 100-161
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000722
Family Chromo domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006936   Gene: ENSMMUG00000005241   Transcript: ENSMMUT00000007379
Sequence length 178
Comment pep:known chromosome:MMUL_1:2:12332294:12332855:-1 gene:ENSMMUG00000005241 transcript:ENSMMUT00000007379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKTKHTADSSSENGEYTVEKVLDTHVVKGQMEYLLMWKGFSEEHNTWESEKNLDCLFT
KKFKMMKEGKITNLGRSQKVARKSNFSNCADSTKSKREQSNDIARGFEIRLEPEKIIGAT
DSCGDMFLMKWKIDEADLVLAKEANVKYLQMTAFYEERLMLHAYLEDAENKEEKTAKG
Download sequence
Identical sequences ENSMMUP00000006936 ENSMMUP00000006936 9544.ENSMMUP00000006936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]