SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006993 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006993
Domain Number 1 Region: 206-325
Classification Level Classification E-value
Superfamily NTF2-like 2.7e-40
Family NTF2-like 0.0000199
Further Details:      
 
Domain Number 2 Region: 66-188
Classification Level Classification E-value
Superfamily L domain-like 2.11e-28
Family mRNA export factor tap 0.0000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006993   Gene: ENSMMUG00000005290   Transcript: ENSMMUT00000007442
Sequence length 335
Comment pep:known chromosome:MMUL_1:X:101164391:101185470:1 gene:ENSMMUG00000005290 transcript:ENSMMUT00000007442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSPSKLLISRGSALTQVWLTAAILGQVGAEQSAWEGDLYGWQLWGWCWCWSSQAPHSLL
LPFSWLPGDLVKNHIDIILNRRNCMAATLKIIERNFPELLSLNLCDNKLHQLDGLPDIIE
KAPKVKTLNLSKNKLKSAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSTIREYFPKL
LRLDGQELGSPIIIGIEAPEIIKPCKESYKGSETIKSLVLQFLLQYYLIYDSEDRKGLLS
VYHDKACFSLTITLNPEDPEPSSLEKYFKDSRNIKNIKDPHLRVQLLKHTKREIVDSLSV
LPRTQHDLNSYVVDLCIQTVSTCFLPQSGPESWSR
Download sequence
Identical sequences ENSMMUP00000006993 9544.ENSMMUP00000006993 ENSMMUP00000006993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]