SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007058 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007058
Domain Number 1 Region: 312-478,869-1044
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.57e-123
Family Mammalian PLC 0.00000689
Further Details:      
 
Domain Number 2 Region: 621-736
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-31
Family SH2 domain 0.0000205
Further Details:      
 
Domain Number 3 Region: 528-641
Classification Level Classification E-value
Superfamily SH2 domain 1.04e-25
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 4 Region: 1062-1183
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.48e-24
Family PLC-like (P variant) 0.0028
Further Details:      
 
Domain Number 5 Region: 15-130
Classification Level Classification E-value
Superfamily PH domain-like 5.19e-20
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 
Domain Number 6 Region: 766-830
Classification Level Classification E-value
Superfamily SH3-domain 7.74e-19
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 7 Region: 160-309
Classification Level Classification E-value
Superfamily EF-hand 0.00000000364
Family Calbindin D9K 0.052
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007058
Domain Number - Region: 477-512
Classification Level Classification E-value
Superfamily PH domain-like 0.0999
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007058   Gene: ENSMMUG00000005334   Transcript: ENSMMUT00000007512
Sequence length 1265
Comment pep:known chromosome:MMUL_1:20:79914860:80105647:1 gene:ENSMMUG00000005334 transcript:ENSMMUT00000007512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTMVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAL
NWLSGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSA
KFLKDKFVEIGAHRDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLIHEQQEHWAQDLSKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKEHAFVTSSFPVILSIEEHCSVEQQRHMAKT
FKEVFGDLLLMKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNVEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTTEEEVPQDIPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYY
LTDNLTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYESLSRGEAEDML
MRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTKIQQYFPSNYVEDISTADVEELEKQII
EDNPLGCLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSITRQKPVDLLRYNQKGLTRIYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKF
MQMNHALFSLNGRTGYVLQPESMRAEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGADYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKAIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNKRLREKRVSN
SKFYS
Download sequence
Identical sequences F7GH26
ENSMMUP00000007058 ENSMMUP00000007058 XP_001111717.1.72884 9544.ENSMMUP00000007058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]