SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007173 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007173
Domain Number 1 Region: 23-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-70
Family FCH domain 0.0032
Further Details:      
 
Domain Number 2 Region: 401-485
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-20
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007173   Gene: ENSMMUG00000005427   Transcript: ENSMMUT00000007636
Sequence length 486
Comment pep:known chromosome:MMUL_1:10:86852934:86894295:-1 gene:ENSMMUG00000005427 transcript:ENSMMUT00000007636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLT
EWARRWRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAF
HKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADP
SLNPEQLKKLQDKIEKCKQDVLKTKDKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKR
LRFFREVLLEVQKHLDLSNVTGYKAVYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQ
FEVRGGTWAHRVGRRCPRSHSRLYDPHGPLQSWDPLKALSLHSTLNVPSNPAQSAQSQSS
YNPFEDEDDTGSTVSEKEDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFD
DDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPAN
YVEAIQ
Download sequence
Identical sequences ENSMMUP00000007173 9544.ENSMMUP00000036944 ENSMMUP00000036944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]