SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007181 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007181
Domain Number 1 Region: 1543-1647,1681-1824
Classification Level Classification E-value
Superfamily Cullin homology domain 4.32e-40
Family Cullin homology domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1142-1298
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.74e-36
Family APC10-like 0.0057
Further Details:      
 
Domain Number 3 Region: 365-439
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.62e-32
Family CPH domain 0.000014
Further Details:      
 
Domain Number 4 Region: 2227-2280
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000698
Family RING finger domain, C3HC4 0.0042
Further Details:      
 
Domain Number 5 Region: 2068-2153
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000177
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 6 Region: 147-197,674-806,986-1077
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000498
Family RPA1889-like 0.078
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007181
Domain Number - Region: 1854-1952
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00254
Family SCF ubiquitin ligase complex WHB domain 0.057
Further Details:      
 
Domain Number - Region: 2140-2208
Classification Level Classification E-value
Superfamily RING/U-box 0.00388
Family IBR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007181   Gene: ENSMMUG00000005434   Transcript: ENSMMUT00000007645
Sequence length 2517
Comment pep:known chromosome:MMUL_1:4:43070686:43115244:1 gene:ENSMMUG00000005434 transcript:ENSMMUT00000007645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGERHAGDLMVPLGPRLQAYPEELIRQRPGHDGHPEYLIRWSVLKCGEVGKVGVEEGKA
EHILMWLSAPEVYANCPGLLGERALSKGPQHEPAGVSGSFPRDPGGPDEVAMGEMEADVQ
ALVRRAARQLAESTPSLTAAVLHTIHVLSAYASIGPLTGVFRETGALDLLMHMLCNPEPQ
IRRSAGKMLQALAAHDAGSRAHVLLSLSQQDGIEQHMDFDSRYTLLELFAETTSSEEHCM
AFEGIHLPQIPGKLLFSLVKRYLCVTSLLDQLNNSPELGAGDQSSPCATREKSRGQRELE
FSMAVGNLISELVRSMGWARNLSEQGMSPPRPTRSIFQPYISGPSLLLPTIVTTPRRQGW
VFRQRSEFSSRSGYGEYVQQTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGIPPVQVFWQ
STGRTYWVHWHMLEILGPEEATEDKASAAVEKGAGATVLGTAFPSWDWNPMDGLYPLPYL
QPEPQKNERVGYLTQAEWWELLFFIKKLDLCEQQPIFQNLWKNVDETLGEKALGEISVSV
EMAESLLQVLSSRFEGSNLNDLLNSQIYTKYGLLSDERSSSSTSRNHSCTPDPEEESKSE
ANFSEEETESPKAKAEAPKTEAEPTKTRTEPPMAQSDSQLFNQLLVTEGMTLPTEMKESA
SEMARALRGPGPRSSLDQHVAAVVATVQISSLDTNLQLSGLCALSQAVEEVTERDHPLVR
PDRSLREKLVKMLVELLTNQVGEKMVVVQALRLLYLLMTKHEWRPLFAREGGIYAVLVCM
QEYKTSVLVQQAGLAALKMLAIASSSEIPTFVTGRDSIHSLFDAQMTREIFASIDSATRP
GSESLLLTVPAAVILMLNTEGCSSAARNGLLLLNLLLCNHHTLGDQIITRELRDTLFRHS
GIAPGTEPMPTTRTILMMLLNRYSEPPGSPEHAALETPIIQGQDGSPELLIRSLVGGPSA
ELLLDLERVLCREGSPGGAVRPLLKRLQQETQPFLLLLRTLDAPGPNKTLLLSVLRVITR
LLDFPEAMVLPWHEVLEPCLNCLSGPSSDSEIVQELTCFLHRLALMHKDYAVVLCCLGAK
EVLSKVLDKHSAQLLLGCELRDLVTECEKYAQLYSNLTSSILAGCIQMVLGQIEDHRRTH
QPINIPFFDVFLRHLCQGSSVEVKEDKCWEKVEVSSNPHRASKLTDHNPKTYWESNGSTG
SHYITLHMHRGVLVRQLTLLVASEDSSYMPARVVVFGGDSTSCISTELNTVNVMPSASRV
ILLENLNRFWPIIQIRIKRCQQGGIDTRVRGVEVLGPKPTFWPLFREQLCRRTCLFYTIR
AQAWSRDIAEDRRRLLQLCPRLNRVLRHEQNFADRFLPDDEAAQALGKTCWEALVSPLVQ
NITSPDAEGVSALGWLLDQYLEQRESSQNPLSRAASFASRVRRLCHLLVHVEPPPGPSPE
PSTRPFSKNSKGRDRSPAPLPVLPSSSLRNITQCWLSVVQEQVGRFLAAAWGAPDFVPRY
CKLYEHLQRAGSELFGPRAAFTLALRSGFSGALLQQSFLTAAHMSEQFARYIDQQIQGGL
IGGAPGVEMLGQLQRHLEPIMVLSGLELATTFEHFYQHYMADRLLSFGSSWLEGAVLEEI
GLCFPNRLPQLMLQSLSTSEELQRQFHLFQLQRLDKLFLEQEDEEEKRLEEEEEEEEEEE
AEKELFIEDPSPAISILVLSPRCWPVSPLCYLYHPRKCLPTEFCDALDCFSSFYSQSQNH
PVLDMGPHRRLQWTWLGRAELQFGNQTLHVSTVQMWLLLNFNHTEEVSVETLLKDSALSP
ELLLQALVPLTSGNGPLTLHEGQDFPHRGVLRLHEPGRQRSGEALWLIPPQAYLNVEKDE
GRTLEQKRNLLSCLLVRILKAHGEKGLHIDQLVCLVLEAWQKGPNPPGTLGHTVAGGVAC
TSTDVLSCILHLLGQGYVKRRDDRPQILMYAAPEPMGPCRGQADVPFCGSQSKTSKPSPE
AVATLASLQLPAGRTMSPQEVEGLMKQTVCQVQETLNLEPDVAQHLLAHCHWGAEQLLQS
YSEDPEPLLLAAGLCVPQAQAVPARPDHCPVCVSPLGCDDDLPSLCCMHYCCKSCWNEYL
TTRIEQNLVLNCTCPIADCPAQPTGAFIRAIVSSPEVISKYEKALLRGYVESCSNLTWCT
NPQGCDRILCRQGLGCGTTCSKCGWASCFNCSFPEAHYPASCGHMSQWVDDGGYYDGMSV
EAQSKHLAKLISKRCPSCQAPIEKNEGCLHMTCAKCNHGFCWRCLKSWKPNHKDYYNCSA
MVSKAARQEKRFQDYNERCTFHHQAREFAVNLRNRVSAIHEVPPPRSFTFLNDACQGLEQ
ARKVVLAYACVYSFYSQDAEYMDVVEQQTENLELHTNALQILLEETLLRCRDLASSLRLL
RTDCLSTGMELLRRIQERLLAILQHSAQDFRVGLQSPSVEAWETKGPNVPGSQPQTSSGP
EAEEEEEDDEDDVPEWQQDEFDEELDNDSFSYDESENLDQETFFFGDEEEDEDEAYD
Download sequence
Identical sequences ENSMMUP00000007181 9544.ENSMMUP00000007181 ENSMMUP00000007181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]