SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007194 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007194
Domain Number 1 Region: 49-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.13e-68
Family Arfaptin, Rac-binding fragment 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007194   Gene: ENSMMUG00000005435   Transcript: ENSMMUT00000007659
Sequence length 484
Comment pep:known chromosome:MMUL_1:3:118096906:118208169:1 gene:ENSMMUG00000005435 transcript:ENSMMUT00000007659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGHKCSYPWDLQDRYPQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKL
ELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKAL
CFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQEL
DPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLH
FWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKEEKKKITQQESTDEAVQEPS
QLISLEEENQRKESSSFKTEDGKSILSALDKSATHTAGSGPIDELLDMKPEEGACLGPVA
GTPEPEGADKDDLLLLSEIFNASSLEEGEFSKEWAAVFGDGQVKEPAAPTMALGEPDPKP
QTGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHE
LLNA
Download sequence
Identical sequences A0A2K5NV05 A0A2K5WRR7 A0A2K6AJ74 I2CU09
9544.ENSMMUP00000007191 NP_001252635.1.72884 XP_005550174.1.63531 XP_005550175.1.63531 XP_005550176.1.63531 XP_007980249.1.81039 XP_007980250.1.81039 XP_011830122.1.47321 XP_011929379.1.92194 XP_011929380.1.92194 XP_011929381.1.92194 XP_011929383.1.92194 XP_011929384.1.92194 XP_011929385.1.92194 XP_014989474.1.72884 XP_014989475.1.72884 XP_014989476.1.72884 XP_014989477.1.72884 XP_014989478.1.72884 XP_015303181.1.63531 XP_015303182.1.63531 ENSMMUP00000007191 ENSMMUP00000007194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]