SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007238 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007238
Domain Number 1 Region: 15-170
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000664
Family Nucleotide and nucleoside kinases 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007238   Gene: ENSMMUG00000005475   Transcript: ENSMMUT00000007706
Sequence length 209
Comment pep:known chromosome:MMUL_1:15:71294646:71295470:1 gene:ENSMMUG00000005475 transcript:ENSMMUT00000007706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSELLHMVILWLPLLAQKFGLQHLSNGHFLWENTKANTEVSDMAKQYTENGLLVPDHVI
TCLMVSELENRWFSEDVRTNRSPDLKTKIYEVDLVISLKIPFETLKDCLSRCWIHPPCSR
VYNLGFNPPGVREIDDISGEPLVQQENGKLEAVAARIRQYKVVTKPVMSPGMLHHFSGME
TDKIWPYAYTFFLTRSHLFSSKRRATCTY
Download sequence
Identical sequences 9544.ENSMMUP00000007238 ENSMMUP00000007238 ENSMMUP00000007238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]