SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007253 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007253
Domain Number 1 Region: 3679-3821
Classification Level Classification E-value
Superfamily SET domain 4.84e-48
Family Histone lysine methyltransferases 0.0044
Further Details:      
 
Domain Number 2 Region: 1322-1392
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000142
Family PHD domain 0.0092
Further Details:      
 
Domain Number 3 Region: 1422-1490
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000184
Family PHD domain 0.0094
Further Details:      
 
Domain Number 4 Region: 1559-1623
Classification Level Classification E-value
Superfamily Bromodomain 0.00000523
Family Bromodomain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007253
Domain Number - Region: 1283-1335
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000864
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007253   Gene: ENSMMUG00000005482   Transcript: ENSMMUT00000007723
Sequence length 3824
Comment pep:known chromosome:MMUL_1:14:116856270:116912000:1 gene:ENSMMUG00000005482 transcript:ENSMMUT00000007723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSET
KSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDNLKKIKRTPSATF
QQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSEL
EKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRIIPSSKRTDATIAKQLLQRAKKGAQ
KKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLE
STPNSRFSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERS
DTPEVHTPLPISQSPENESNDRRSRRYSVSERSFGSRTTKKLTLQSAPQQQTSSSPPPPL
LTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHS
RSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTATSARLFSPLHSG
TRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSNRTSAGTSSSGVSNRKRKRKVFSPIR
SEPRSPSHSMRTRSGRLSTSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQ
SGESAEKNQRPRKQTSAPPEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDAD
KSVEKDKSRERDREREKENKRESRKEKRKKGSEIQSSSALYPVGRVSKEKVVGEDVATSS
SAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEK
EKTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQ
TDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKIL
SSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPE
DCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEK
KESKESSVVKNVVDSSQKPTPSAREDPAPKKSSSEPPPRKPVEEKSEEGNVSAPGPESKQ
ATIPASRKSSKQVSQPAPVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQK
KVAPRPSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDF
KEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENER
PLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVW
ICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKM
MQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEKELQISLK
QVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQP
LDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERV
FPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLMKKIIP
APKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSAN
DAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGC
CLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGIS
LRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRC
VYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKENQNTAEIISPPSPDRP
PHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSS
GLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTIGTATDLESSAKAVDH
VLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLASKSSSLKG
EKTKVLSSKSSEGSAHNVAYPGIPKLTPQVHNTTSRELNVSKIGSFAEPSSVSFSSKEAL
SFPHLHLRGQRNDRDQHTDSTQSANPSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDR
RQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSD
KIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNTLKESSPA
SPLQIESTSPPEPISASENPADGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPK
PQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQV
DGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLDGVDDGTE
SDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVIKSSVGHKNEPKMDNCHS
VSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNIL
PSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTTE
PVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEK
SVASSEGDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRN
SSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNM
QPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGSGLTLTTGLNPSLPTSQSL
FPSASKGLLPMSHHQHLHSFPAATQSSFPPNISSPPSGLLIGVQPPPDPQLLVSESSQRT
DLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNH
PNLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATASGTSTISQDTSH
LTSGSVSGLASSSSVLNVVSMQTTTTPTSSAPVPGHVTLTNPRLLGTPDIGSISNLLIKA
SQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAMTAASSICVLPSTQTTGVTAASPSGE
ADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSVGLEQNKALSSAV
QASSTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSS
EAHIPDQEATSLTSGTGTPGAEAEQQDTANVEQSSQKECGQPAGQVAVLPEVQVTQNPAN
EQESTEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAES
IEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKF
RFHKPEEANEPPLNPHGSARAEVHLRQSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKS
ARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRS
IQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKH
IVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
Download sequence
Identical sequences ENSMMUP00000007251 9544.ENSMMUP00000007251 ENSMMUP00000007253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]