SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007300 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007300
Domain Number 1 Region: 116-415
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.96e-111
Family Pancreatic carboxypeptidases 0.00000000105
Further Details:      
 
Domain Number 2 Region: 17-108
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 2e-24
Family Pancreatic carboxypeptidase, activation domain 0.0000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007300   Gene: ENSMMUG00000005518   Transcript: ENSMMUT00000007770
Sequence length 417
Comment pep:known chromosome:MMUL_1:2:138931594:138963364:-1 gene:ENSMMUG00000005518 transcript:ENSMMUT00000007770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALLVLATVALASAHHGGEHFEGEKVFRVNVEDENHINVIRNLASTTQIDFWKPDSVTQ
IKPHSTVDFRVKAEDIVTVENVLKQNELQHEVLISNLRNVVEAQFDSRVRATGHSYVKYN
KWETIEAWTQQVATENPALISRSVIGTTFEGRDIYLLKVGKAGQNKPAIFIDCGFHAREW
ISPAFCQWFVREAVRTYGSEIQITELLNKLDFYILPVLNIDGYIYTWTKSRFWRKTRSTH
AGSSCVGTDPNRNFDAGWCEIGASRNPCDETYCGPAAESEKETKALADFIRNNLSSIKAY
LTIHSYSQMLIYPYSYAYKVGENNVELNTLAKAAVKELASLHGTKYTYGPGATTIYPAAG
GSDDWAYDQGIRYSFTLELRDTGRYGFALPESQIRATCEETLLAIKYIASYVLEHLY
Download sequence
Identical sequences 9544.ENSMMUP00000007300 ENSMMUP00000007300 XP_014987254.1.72884 ENSMMUP00000007300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]