SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007317 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007317
Domain Number 1 Region: 4-282
Classification Level Classification E-value
Superfamily ClpP/crotonase 9.76e-58
Family Crotonase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 296-476
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.85e-46
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00039
Further Details:      
 
Domain Number 3 Region: 478-585
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 5.44e-22
Family HCDH C-domain-like 0.00085
Further Details:      
 
Domain Number 4 Region: 615-705
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 9.35e-20
Family HCDH C-domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007317   Gene: ENSMMUG00000005531   Transcript: ENSMMUT00000007787
Sequence length 723
Comment pep:known chromosome:MMUL_1:2:101390197:101460661:1 gene:ENSMMUG00000005531 transcript:ENSMMUT00000007787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYTRLHNALALIRLRNPPVNAISTAVLRDVKEGLQKAVIDHTIKAIVICGAEGKFSAG
ADIHGFSAPRTFGLTLGHVVDEIQRNVKPVVAAIQGMAFGGGLELALGCHYRIAHTEAQV
GLPEVTLGLLPGARGTQLLPRLIGVPAALDLITSGRHILAGEALKLGILDKVVNSDPVEE
AIRFAQTVSDQPLESRRLCNKPIQSLPNMDTIFSEVLLKMQKQHPGCLAQEACVRAVQAA
VQYPYEVGIKKEEELFLYLFQSGQARALQYAFFAERKANKWSTPSGASWKTASAQPVSSV
GVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKIITSVLEKEASKMQQSGHPWSG
PKPKLTSSMKELGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLCTNTSALDVDEIAS
STDRPHLVIGTHFFSPAHVMKLLEVIPSRYSSPTTIATVMNLSKKIKKIGVVVGNCFGFV
GNRMLNPYYNQTYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLT
GPTLPPGTPARKRGNRRYCPIPDMLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFL
SQYRETYHIEPRTISQDEILERCLYSLINEAFHILGEGIATSPEHIDVVYLHGYGWPRHK
GGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKEWQSLAGSPS
SNL
Download sequence
Identical sequences F7GFA8
9544.ENSMMUP00000007317 NP_001244421.1.72884 XP_005546644.1.63531 ENSMMUP00000007317 ENSMMUP00000007317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]