SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007344 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007344
Domain Number 1 Region: 41-239
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000108
Family BAR domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007344   Gene: ENSMMUG00000005557   Transcript: ENSMMUT00000007817
Sequence length 320
Comment pep:known chromosome:MMUL_1:8:96274200:96303738:1 gene:ENSMMUG00000005557 transcript:ENSMMUT00000007817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPGGCLRPSARPGALESPSLGPRKVPCRARGSMMRRTLENRNAQTKQLQTAVSNVEKHF
GELCQIFAAYVRKTARLRDKADLLVNEINAYAATETPHLKLGLMNFADEFAKLQDYRQAE
VERLEAKVVEPLKAYGTIVKMKRDDLKATFTARNREAKQLTQLERTRQRNPSDRHVIAET
ELQRAAMDASRTSRHLEETINNFERQKMKDIKTIFSEFITIEMLFHGKALEVYTAAYQNI
QNIDEDEDLEVFRNSLYAPDYSSRLDIVRANSKSPLQRSLSAKCVSGTGQVSTCRLRKDQ
QADDDEDEELDVTEEENFLK
Download sequence
Identical sequences ENSMMUP00000007344 9544.ENSMMUP00000007344 ENSMMUP00000007344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]