SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007359 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007359
Domain Number 1 Region: 283-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-63
Family SPRY domain 0.0000123
Further Details:      
 
Domain Number 2 Region: 9-84
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-20
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 3 Region: 91-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000305
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007359   Gene: ENSMMUG00000005570   Transcript: ENSMMUT00000007832
Sequence length 486
Comment pep:known chromosome:MMUL_1:1:209116403:209140430:-1 gene:ENSMMUG00000005570 transcript:ENSMMUT00000007832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGPPGERLREEARCPVCLDFLQEPVSVDCGHSFCLRCISEFCEKSDVAQGGVYACPQC
RGPFRPAGFRPNRQLAGLVDSVRRLGLGAGPGARRCARHGEELSRFCEEDQAALCWVCDA
GPDHRTHRTAPLQEAAGRYQVKLQMALELVRKELEDALTQEASVGKKTVIWKEKVEMQRQ
RFRLEFEKHRGFLAQEEQLQLRRLEAEERATLQRLRESKSRLVQQSKALKELADELQERC
QRQALGLLEGVKGVLSRSKAVTRLEAESIPMELKTACRIPGRRELLRKFQVDVKLDPATA
HPSLLLTADLRSVQDGELWRDVPNNPERFDTWPCILGLQSFSSGRHYWEVLVEERAEWGL
GVCQDTLPRKGETTPSPENGVWALWLLKGNEYMVLASSSVPLLLLESPRCIGIFLDYEAG
EISFYDVTNGSYIYTFNQLFSGLLRPYFFICDATPLILPPMTVAESGNWASRDHLDPASD
VRDDHL
Download sequence
Identical sequences F7GB58
ENSMMUP00000007358 ENSMMUP00000007359 XP_001086222.1.72884 9544.ENSMMUP00000007358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]