SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007381 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007381
Domain Number 1 Region: 55-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.75e-34
Family Laminin G-like module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007381   Gene: ENSMMUG00000005577   Transcript: ENSMMUT00000007854
Sequence length 923
Comment pep:known chromosome:MMUL_1:4:66642843:66666085:-1 gene:ENSMMUG00000005577 transcript:ENSMMUT00000007854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTCWKIPVFFFVCSFLEPWASAAVKRRPRFPANSNSNGENELCPKIRIGQDDLPGFDLI
SQFQVDKAASRRAIQRVVGSATLQVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMT
GSTLKKNWNIWQIQDSSGKEQVGIKINGQTQSVAFSYKGLDGSLQTAAFSNLPSLFDSQW
HKIMIGVERSSATLFVDCNRIESLPIKPRGPIDTDGFAVLGKLADNPQVSVPFELQWMLI
HCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGP
PGPPGPAGEPGKPGAPGKPGTPGADGLTGPDGSPGSVGPKGQKGEPGVPGSRGFPVSKIL
PFIPTGPPGTAGLPGELGRVGPVGDPGRRGRPGPPGPPGPRGTIGFHDGDPLCPNACPPG
RSGYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQGELGEVGAQGPPGAQGLRGITGIVG
DKGEKGARGLDGEPGPQGLPGAPGDQGQRGPPGEAGPKGERGAQGARGIPGLPGPKGDTG
LPGVDGRDGIPGMPGTKGEPGKPGPPGDAGLQGLPGVPGIPGAKGVAGEKGSTGAPGKPG
PMGNSGKPGQQGPPGEVGPRGPRGLPGSRGELGPVGSPGLPGKLGSLGSPGLPGLPGPPG
LPGMKGDRGVVGEPGPKGEQGASGEEGETGERGELGDIGLPGPKGSAGNPGEPGLRGPEG
SRGLPGVEGPRGPPGPRGVQGEQGATGLPGVQGPPGRAPTDQHIKQVCMRVIQEHFAEMA
ASLKRPDSGASGLPGMPGPPGPPGPPGENGFPGQMGMRGLPGIKGPPGALGLRGPKGDLG
EKGERGPPGRGPKGLPGAVGLPGDPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPGLP
GFCEPASCTMQAGQRAFSKGPDP
Download sequence
Identical sequences ENSMMUP00000007386 ENSMMUP00000007381 9544.ENSMMUP00000007386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]