SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007399 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007399
Domain Number 1 Region: 51-130
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.34e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.000038
Further Details:      
 
Domain Number 2 Region: 151-231
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.37e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000033
Further Details:      
 
Domain Number 3 Region: 242-328
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.82e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000464
Further Details:      
 
Domain Number 4 Region: 343-415
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.33e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007399   Gene: ENSMMUG00000005597   Transcript: ENSMMUT00000007873
Sequence length 629
Comment pep:known chromosome:MMUL_1:19:6317090:6326013:-1 gene:ENSMMUG00000005597 transcript:ENSMMUT00000007873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPPPRT
SMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQK
AKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERA
GVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGG
GIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAA
RIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNWGPPGGEMTFSIPTHKCGLVIGRG
GENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGPLCPVG
PGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPS
KAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQPPPTGQSDYTKAWE
EYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSVPSPLFSS
PPALAQLLRPRPSPLPGLVCCLFICSRGD
Download sequence
Identical sequences ENSMMUP00000007399 9544.ENSMMUP00000007399 ENSMMUP00000007399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]