SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007439 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007439
Domain Number 1 Region: 846-1179
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.09e-104
Family Hect, E3 ligase catalytic domain 0.0000000393
Further Details:      
 
Domain Number 2 Region: 450-485
Classification Level Classification E-value
Superfamily WW domain 0.00000000000654
Family WW domain 0.0014
Further Details:      
 
Domain Number 3 Region: 621-663
Classification Level Classification E-value
Superfamily WW domain 0.000000000024
Family WW domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007439   Gene: ENSMMUG00000005627   Transcript: ENSMMUT00000007914
Sequence length 1179
Comment pep:known chromosome:MMUL_1:12:59854796:59958458:-1 gene:ENSMMUG00000005627 transcript:ENSMMUT00000007914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGSHHDSQLCSNGPVSEDSAADGAPKHSFRTSSTLEIDTEELTSTSSRTSPPRGRQDSL
NDYLDAIEHNGHSRPGTATCSERSMGASPKLRSSFPTDTRLNAMLHIDSDEEDHEFQQDL
GYPSSLEEEGGLIMFSRAPRADDGSLTSQTKLEDNPVENEEASTHEAASLEDKPENLPEL
AEGSLPAGPAPEEGEGGPESQPSADQASAELCGSQEVDQPTSGADTGTSDASGGSRRAVS
ETESLDQGSEPSQVSSETEPSDPARTESVSEASTRPEGESDLECADSSCNESVTTQLSSV
ETRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPAEGSQDSVCTAGSLPVVQVPSGE
EEGPGAESATVPDQEELGEVWQRRGSLEGAAAAAESPPQEEGSAGEAQGTCEGATAQEEG
ATGGSQANGHQPLRSLPSVRQDVSRYQRVDEALPPNWEARIDSHGRIFYVDHVNRTTTWQ
RPTAPPAPQVLQRSNSIQQMEQLNRRYQSIRRTMTNERPEENTNAIDGAGEEADFHQASA
DFRRENILPHSTSRSRLTLLLQSPPVKFLISPEFFTVLHSNPSAYRMFTNNTCLKHMITK
VRRDTHHFERYQHNRDLVGFLNMFANKQLELPRGWEMKHDHQGKAFFVDHNSRTTTFIDP
RLPLQSSRPTSALVHRQHLTRQRSHSAGEVGEDSRHAGPPVLPRPSSTFNTVSRPQYQDM
VPVAYNDKIVAFLRQPNIFEILQERQPDLTRNHSLREKIQFIRTEGTPGLVRLSSDADLV
MLLSLFEEEIMSYVPPHALLYPSYCQSPRGSPVSSPQNSPGTQRANARAPAPYKRDFEAK
LRNFYRKLETKGYGQGPGKLKLIIRRDHLLEDAFNQIMGYSRKDLQRNKLYVFVGEEGLD
YSGPSREFFFLVSRELFNPYYGLFEYSANDTYTVQISPMSAFVDNHHEWFRFSGRILGLA
LIHQYLLDAFFTRPFYKALLRILCDLSDLEYLDEEFHQSLQWMKDNDIHDILDLTFTVNE
EVFGQITERELKPGGANIPVTEKNKKEYIERMVKWRIERGVVQQTESLVRGFYEVVDARL
VSVFDARELELVIAGTAEIDLSDWRNNTEYRGGYHDNHIVIRWFWAAVERFNNEQRLRLL
QFVTGTSSIPYEGFASLRGSNGPRRFCVEKWGKITALPR
Download sequence
Identical sequences ENSMMUP00000007439 ENSMMUP00000007439 9544.ENSMMUP00000007439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]