SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007441 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007441
Domain Number 1 Region: 440-850
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.28e-119
Family PIWI domain 0.0031
Further Details:      
 
Domain Number 2 Region: 105-340
Classification Level Classification E-value
Superfamily PAZ domain 8.63e-59
Family PAZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007441   Gene: ENSMMUG00000005629   Transcript: ENSMMUT00000007916
Sequence length 850
Comment pep:known chromosome:MMUL_1:11:131610581:131640205:1 gene:ENSMMUG00000005629 transcript:ENSMMUT00000007916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRARARARGRARGQETVPLGELARFPVLKKISLYDPSVSSGWIQKSRNKSNDELQISA
GFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFRLTSRPQWAL
YQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQQKVTEVFSKTRNGE
DVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPNDPIDIPSHRLVIW
PGFTTSILQYENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVL
TKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKNSLTRVAHLEQVAFKAVCKFL
KRPSKANSKKEQLLTRIILVITLRDGRISDGLGLKIISRKQSRRRVFGREDRLRTCCDVV
LLGCPVELCGLLFWGARWSCVVCSSGVPGGAVWIQDMVDYNPQFADWSKETRGAPLISVK
PLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMKKAIMIEVDDRTEAYLRVLQQKVTT
DTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCK
MGGELWRVDIPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQEL
VDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGY
NPRLTVIVVKKRVNARFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSP
THYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPN
LSLSNRLYYL
Download sequence
Identical sequences 9544.ENSMMUP00000007441 ENSMMUP00000007441 ENSMMUP00000007441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]